KEGG   Lactobacillus kefiranofaciens: WANG_0296Help
Entry
WANG_0296         CDS       T01526                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    WANG_0296 (lacZ)
Enzymes [BR:lke01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     WANG_0296 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
309370..311376
Genome map
AA seq 668 aa AA seqDB search
MTQTLTRFLYGGDYNPNQWPEDTWTKDIKVFKQADLNSATINIFSWALLEPEEGKYDFSK
LDKIIAELSEVNFDIVLGTSTAAMPAWMFKKYPDVARVDYQGRRHVFGQRHNFCPNSKNY
QRLAGELVEKLAERYSNNPHIVVWHVNNEYGGNCYCENCQNAFREWLKNKYQTLDNLNHA
WNMNVWSHTIYHWDEIVVPNELGDAWGPEGTETIVAGMSIDYLRFQSESLQNLFKLEKRI
IKKYDPETPVTTNFHSLPNKMIDYQKWAKDQDIISYDSYPTYDAPAYKPAFLYDLMRSLK
HQPFILMESAPSQVNWQPYSPLKRPGQMVATELQAVAHGADTVQFFQLKQAVGGSEKFHS
AVIAHSQRTDTRVFKELTALGKKLKKAGPTILGSKTNAKVGIIFDWSNFWSYEFVDGISQ
DMNYVESILDYYRKFYERNILTDIISVDDDFSKYDLLVAPVLYMVKPGLGEKINDYVKQG
GNFVTTYMSGMVNETDNVYLGGYPGPLKDVTGIWVEESDAVVPGHKTTVSLNGQTYNAGF
ICDLIHSGDAKVLAKYANEFYAGTPAITENEYGQGKTWYVGTRLDHQGLTQLFNHIVLST
GVKSLVGDSHKLEVTKRVTQDGKKLYFVLNMSNEERELPTEFNNYPNLLTGELAQVKMRA
WDVQVLVK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaactttaacacgctttttatatggcggagattataatcctaatcaatggcct
gaagatacttggaccaaggatattaaggtgttcaagcaagctgatttgaattcagcgacg
attaacatcttttcatgggcattgcttgaacctgaagaaggcaagtatgactttagcaag
ttagacaagattattgcagaattgtctgaggttaattttgacattgtattaggtacctca
acagctgcgatgccagcttggatgttcaaaaaatatccggatgttgcccgcgttgattat
caaggcagacgtcatgttttcggacagcgtcacaacttctgccctaatagtaaaaactat
caaagattagctggtgagttagtagagaagctcgctgagcgctatagcaataatccacat
attgtggtttggcacgttaataatgaatatggcggcaactgttattgcgagaattgtcag
aacgcttttcgtgaatggctaaaaaataagtatcagactttagataatttaaatcatgct
tggaatatgaatgtttggagtcatactatctatcattgggatgaaattgtcgtaccaaat
gaactaggggatgcttggggtccagaaggaaccgagacgattgtcgctggcatgtcgatt
gactatctgcgtttccaatccgagagtttacaaaatctatttaagttagaaaaacgaatt
attaagaaatatgacccagaaacgccagtgacaactaattttcatagtttgccaaataag
atgattgattatcaaaaatgggctaaagatcaggatattatctcttatgattcttatcca
acctatgatgctccagcttataagccggcctttctttatgacttaatgcgctcactcaaa
caccagccattcatattaatggaatcggcaccttcacaggttaactggcagccttatagt
ccactgaagcgtccaggtcaaatggtagcaacggaattgcaagctgtagctcatggtgcg
gataccgtgcagttcttccagttgaagcaagcagttggtggctctgaaaaattccatagt
gctgtaattgcgcactcacagagaacggataccagagtatttaaggaattaactgcctta
ggaaaaaagctgaaaaaggctggtccaactatcttgggttcaaagactaatgctaaagtg
gggatcatctttgactggagcaacttctggtcttatgaattcgttgatggcattagccaa
gatatgaactatgttgagtcaattttggattattaccgtaaattttatgaacgcaatatt
ctaactgatattattagcgtcgatgatgatttcagtaaatatgatctgttggtagcacca
gttttatacatggttaagcctggattaggagaaaagattaacgactatgtcaaacagggt
ggcaattttgttactacctatatgtctggtatggttaatgaaacggataacgtttattta
ggtggctatcctggtccacttaaggatgtaacaggcatctgggtggaggaaagcgacgca
gttgtgccagggcataagacgactgtttccttgaatggtcaaacttataatgcaggcttc
atctgtgacttgattcattcaggggatgctaaggttttagccaaatatgccaacgagttt
tatgctggcacgcctgctataactgagaatgaatatggtcaaggcaagacatggtatgtt
ggtaccagactagatcatcaaggcttaacacagttgtttaatcatattgtgttgtctact
ggggttaaatccttagtaggtgatagtcataagttagaggtgactaagcgtgttacccaa
gatggcaagaaattgtacttcgttttgaacatgagcaatgaagaacgagaattgccaact
gaatttaataattatccaaatttattaactggtgaattagctcaagttaagatgagagct
tgggacgtgcaagttttggttaaatag

DBGET integrated database retrieval system