KEGG   Lactobacillus kefiranofaciens: WANG_0472Help
Entry
WANG_0472         CDS       T01526                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
lke00260  Glycine, serine and threonine metabolism
lke00750  Vitamin B6 metabolism
lke01100  Metabolic pathways
lke01110  Biosynthesis of secondary metabolites
lke01120  Microbial metabolism in diverse environments
lke01230  Biosynthesis of amino acids
Module
lke_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WANG_0472 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    WANG_0472 (thrC)
Enzymes [BR:lke01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     WANG_0472 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Phage_base_V
Motif
Other DBs
NCBI-ProteinID: AEG40167
Position
complement(508037..509527)
Genome map
AA seq 496 aa AA seqDB search
MQYRSTRGSKNQTLNSPAAIIQGLAPDGGLYVPVKFPKADFKLEDLPKLSYKQIAAMIIS
LFFDDFSKEQIKSAVINAYSEQWDDRSIVPIEKHDHNFYMELFHGPTLAFKDIALQMLPQ
LMTRAVQIEQTDHKIIILTATSGDTGTASMRGFANQAGTDVIVFYPEGGVSPVQLKQMLS
QRGKNLQAIAIKGNFDDAQTEVKKIFNDEHFKMRLIQNDFQFSSANSMNIGRLVPQISYY
LYTYGQLVRRQEIKLGDEVNFTVPTGNFGDILAGYYAKKLGLPIKKLICASNENNVLTDF
FENGVYDKRRKFHVTNAPAMDILVSSNLERLLFDLYDENNQQIASLMNQLTQRGHYQIDK
QIFTQLKHIFSAGFATQKQVQAEIKRIYNYDRYVIDPHTAVGSYVAHQYQKQTSDTTKMI
IISTASPYKFPETVYEAITGRECPQTGIPAIKKLHEKLGGQLAIGVRALSDREPHAEKII
EPADMEKMISTILNLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcgtagtactcgcggttccaaaaatcagactttaaattcacccgctgcaatt
attcaaggattggccccagacggcggtttatacgtaccggtaaagtttccaaaagctgat
tttaaattagaagacttacctaaactttcttataaacaaattgccgctatgattattagt
ttatttttcgatgatttttcaaaagagcaaattaaatccgcagttattaatgcttacagt
gaacaatgggatgatcgtagtattgtgccaattgaaaagcatgaccataacttctacatg
gagctctttcatggtcctacattagcttttaaagacatcgccttgcaaatgctgccacag
ttaatgacacgtgctgtccaaattgaacagactgatcataaaattattatcttgacggct
acttctggagacaccggaactgcttcaatgcgtggttttgctaaccaagcaggaacagat
gtgattgtcttctatcctgaaggcggtgttagtccagttcaattaaagcaaatgctcagc
caacgtggcaaaaatttgcaggctattgctattaaaggcaacttcgatgatgctcaaacc
gaagtcaaaaaaatctttaatgatgagcacttcaaaatgcgacttattcaaaatgatttt
caattctcttctgccaattccatgaatattggtcgtttagtgccacaaatctcttattat
ctctacacttacgggcaattagttcgtcggcaagaaattaaattaggcgacgaggtaaac
tttacagtccccactggcaactttggtgatattttagctggctactatgccaaaaaattg
ggtttgccaataaaaaaactaatttgcgcctctaatgaaaacaatgtcctaaccgatttc
ttcgagaacggcgtttatgacaagcggcgtaaattccatgtgactaatgcacctgcaatg
gatattttggtttccagcaacctggaaagattattgtttgatctttatgatgaaaacaac
cagcaaattgctagtctaatgaatcaattaacccagcgcggtcattatcaaatagataag
cagatcttcacccaattaaagcatatcttttctgctggcttcgccactcaaaagcaagtc
caagcagaaattaaacggatttataattatgatcgctatgtcatcgatccacataccgca
gtcggctcttatgttgctcaccaatatcaaaaacaaactagtgacaccactaaaatgata
atcatctctactgctagtccttataagtttcctgaaaccgtctatgaggctattactggt
cgtgaatgtcctcaaactggcatcccagctattaagaaattacatgagaaacttgggggt
caattagcaatcggcgtacgtgctttgtctgaccgcgaacctcatgcggaaaagataatc
gaaccagccgatatggaaaagatgattagtactattttaaatttgaaataa

DBGET integrated database retrieval system