KEGG   Lactobacillus kefiranofaciens: WANG_0712Help
Entry
WANG_0712         CDS       T01526                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
lke00010  Glycolysis / Gluconeogenesis
lke00030  Pentose phosphate pathway
lke00051  Fructose and mannose metabolism
lke00052  Galactose metabolism
lke00680  Methane metabolism
lke01100  Metabolic pathways
lke01110  Biosynthesis of secondary metabolites
lke01120  Microbial metabolism in diverse environments
lke01130  Biosynthesis of antibiotics
lke01200  Carbon metabolism
lke01230  Biosynthesis of amino acids
lke03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WANG_0712 (pfk)
   00030 Pentose phosphate pathway
    WANG_0712 (pfk)
   00051 Fructose and mannose metabolism
    WANG_0712 (pfk)
   00052 Galactose metabolism
    WANG_0712 (pfk)
  Energy metabolism
   00680 Methane metabolism
    WANG_0712 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    WANG_0712 (pfk)
Enzymes [BR:lke01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     WANG_0712 (pfk)
Protein phosphatases and associated proteins [BR:lke01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     WANG_0712 (pfk)
Messenger RNA biogenesis [BR:lke03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     WANG_0712 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AEG40407
Position
complement(773106..774068)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFIPLTTENVDHK
ISEGGTFLYSARYPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRV
GVASGADAIVIPERSYDVKEIAGTLTRGFADGKDHGIIVLAEGVMAADKFKDELLKYGDF
DARANVLAHMQRGGSPTVEDRVNATKMGNYAVKLLLDGKGGLAVGMENGKLNTHDILDLF
DGKHHGDYALMDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagacgcccctggtatgaatgcagcaatt
agagctgttactaagactgctatccatcatggacttgaagtctttggaattcgttatggt
ttcgctggtttggttgcaggcgactttattccgcttactacggaaaatgttgaccacaag
attagtgaaggcggtacgtttttgtacagtgctcggtatccagaatttgcacaagaagaa
gtgcaacaaaagggtgttgagcaattaaagaagcatggtattgatgctgttatcgttatt
ggcggtgacggatcataccacggtgctttagccttaactcgccacggcgtaaactcagtt
ggtctaccaggaactatcgataatgatattccttatactgactacacgatcggctttgat
tctgcatgtcgtactgctatggacgcaattgataagattcgtgacacagcaagcagtcac
caccgcgtattcgttgttaacgtaatgggccgtgaatgtggtgacattgctatgcgtgtt
ggtgtagctagtggtgcagacgcaattgttattcctgaacgttcttacgatgttaaggaa
attgcaggaactcttactagaggatttgcagatggcaaagatcatggtatcattgtctta
gcagaaggcgttatggctgctgataaatttaaggatgaattacttaaatacggtgacttt
gatgctcgtgctaatgtccttgcacatatgcaacgtggtggctcaccaactgttgaagat
agagtaaatgctactaagatgggtaactatgctgttaagttgcttctcgatgggaagggc
ggtttagctgtcggcatggagaacggcaaacttaatacccacgacattctcgatttattc
gatggaaaacaccacggcgattatgcgctaatggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system