KEGG   Lactobacillus kefiranofaciens: WANG_0712Help
Entry
WANG_0712         CDS       T01526                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WANG_0712 (pfk)
   01230 Biosynthesis of amino acids
    WANG_0712 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WANG_0712 (pfk)
   00030 Pentose phosphate pathway
    WANG_0712 (pfk)
   00051 Fructose and mannose metabolism
    WANG_0712 (pfk)
   00052 Galactose metabolism
    WANG_0712 (pfk)
  Energy metabolism
   00680 Methane metabolism
    WANG_0712 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    WANG_0712 (pfk)
Enzymes [BR:lke01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     WANG_0712 (pfk)
Protein phosphatases and associated proteins [BR:lke01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     WANG_0712 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(773106..774068)
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAPGMNAAIRAVTKTAIHHGLEVFGIRYGFAGLVAGDFIPLTTENVDHK
ISEGGTFLYSARYPEFAQEEVQQKGVEQLKKHGIDAVIVIGGDGSYHGALALTRHGVNSV
GLPGTIDNDIPYTDYTIGFDSACRTAMDAIDKIRDTASSHHRVFVVNVMGRECGDIAMRV
GVASGADAIVIPERSYDVKEIAGTLTRGFADGKDHGIIVLAEGVMAADKFKDELLKYGDF
DARANVLAHMQRGGSPTVEDRVNATKMGNYAVKLLLDGKGGLAVGMENGKLNTHDILDLF
DGKHHGDYALMDVNEEMTKY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggattggtattttaactagtggtggagacgcccctggtatgaatgcagcaatt
agagctgttactaagactgctatccatcatggacttgaagtctttggaattcgttatggt
ttcgctggtttggttgcaggcgactttattccgcttactacggaaaatgttgaccacaag
attagtgaaggcggtacgtttttgtacagtgctcggtatccagaatttgcacaagaagaa
gtgcaacaaaagggtgttgagcaattaaagaagcatggtattgatgctgttatcgttatt
ggcggtgacggatcataccacggtgctttagccttaactcgccacggcgtaaactcagtt
ggtctaccaggaactatcgataatgatattccttatactgactacacgatcggctttgat
tctgcatgtcgtactgctatggacgcaattgataagattcgtgacacagcaagcagtcac
caccgcgtattcgttgttaacgtaatgggccgtgaatgtggtgacattgctatgcgtgtt
ggtgtagctagtggtgcagacgcaattgttattcctgaacgttcttacgatgttaaggaa
attgcaggaactcttactagaggatttgcagatggcaaagatcatggtatcattgtctta
gcagaaggcgttatggctgctgataaatttaaggatgaattacttaaatacggtgacttt
gatgctcgtgctaatgtccttgcacatatgcaacgtggtggctcaccaactgttgaagat
agagtaaatgctactaagatgggtaactatgctgttaagttgcttctcgatgggaagggc
ggtttagctgtcggcatggagaacggcaaacttaatacccacgacattctcgatttattc
gatggaaaacaccacggcgattatgcgctaatggatgtaaatgaagaaatgactaaatat
taa

DBGET integrated database retrieval system