KEGG   Lactobacillus kefiranofaciens: WANG_0770Help
Entry
WANG_0770         CDS       T01526                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WANG_0770
Enzymes [BR:lke01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     WANG_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
842464..843783
Genome map
AA seq 439 aa AA seqDB search
MQTEGAWNEDGKGLSVYDVRPATDNTSDWHVAIDEYHRYDEDLDLLKNMNMYRIQISWSR
VCPDGDGDFNQKGIDFYDRLVNAMLKRGIQPMICLYHFDMPLNLAQKYNGFMSQHVVDAF
VRFGKKMIDHFSDRVKYWIVFNEHNLYFQDEVFNISGYESGDKSLDDMYTIFHHTMMCHI
RLANYIHENYSDVKIGGMLAYQQIYPATSKPEDVWAAKQVQEFLNFNIYDADTGRGYSLE
VMQYAKNHGIEMDITDEDKEIMKKAKADFLAFSYYSSWVLSSNKIPEGEAPNRYLNKGGV
ESKYVKTNDWGWAIDPLGFRNAITTMYNYYRIPIFPIENGIGLKETWDGEHMIEDDERIA
YHRDHIKAMKDAIFDDGAEVLGYLGWGLIDIPSSHADMEKRYGAVYVNSSNHDLKDLKRV
PKKSFYWFQKVLKDNGDEL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactgaaggtgcatggaatgaagacggcaagggtctttcagtctatgatgtccga
cctgctactgacaatactagtgactggcatgtagcaattgatgaatatcatagatatgat
gaagacctcgacttactgaagaacatgaacatgtaccgtattcaaatttcatggtctcgt
gtctgtcccgacggtgacggcgacttcaatcaaaaaggtattgacttctatgatcgatta
gttaatgcaatgcttaaacgtggcattcaaccaatgatctgtctttaccactttgatatg
ccactcaacttagcccaaaagtacaatggctttatgtcacagcatgtagttgacgccttt
gtccgttttggtaaaaaaatgatcgatcattttagtgatcgagtgaaatattggattgtt
ttcaatgaacataatctatatttccaagatgaagtttttaatatttcaggttacgaatct
ggagataagagtttggacgatatgtacactatcttccatcatacgatgatgtgtcatatc
cgattagcaaattacatccatgaaaattactcagatgtaaaaatcggtggaatgcttgct
taccaacaaatttatccagcaacgagtaaacccgaagatgtttgggcagcaaagcaagta
caagagtttttaaactttaatatttacgatgctgacactggacgtggttattcactagaa
gtaatgcaatatgctaaaaatcatggcattgaaatggacattacagatgaagataaagaa
ataatgaagaaagctaaagctgacttcttagcattttcttactattcatcctgggtttta
tccagcaataaaattcctgaaggtgaagctcctaaccgttaccttaacaaaggcggagtt
gaatccaaatatgttaagacaaacgattggggctgggcaattgatccactaggatttagg
aatgcaattactacaatgtacaactactaccgcatccctattttccctattgaaaatggt
attggcctcaaggaaacttgggacggcgagcatatgatcgaagatgatgagcgtattgct
tatcaccgagatcatatcaaagctatgaaagacgctatttttgatgacggtgccgaagta
cttggttatctcggctggggtttaattgatattccaagttcccatgctgatatggaaaag
cgctacggtgctgtatatgtcaacagttcaaatcatgatttaaaagatttaaaacgtgta
cctaagaaatcattctactggttccaaaaggtacttaaagataatggagatgaattataa

DBGET integrated database retrieval system