KEGG   Lactobacillus kefiranofaciens: WANG_0890Help
Entry
WANG_0890         CDS       T01526                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    WANG_0890
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    WANG_0890
Enzymes [BR:lke01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     WANG_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971067..972224
Genome map
AA seq 385 aa AA seqDB search
MKKKTLFFITLASAILLVTGCSHEVKKVSKSSNKTSQVAKPKKKTKKPDRIKQIMSKMTL
DEKIGQLYFAHSTGNFSQMKHNVNKYHLGGTTLFAPDFKNKSKVQFIQEMREYQSSSNHG
LLIATDQEGGTVTRIDSNPKISSRKYPSPQEVYNSHGLQGIQKEDSEVAHILHQNGINMN
FAPVADVAKNKNSFIYNRTLGQNYEITAKYIPVAVKAIQSQKVASCLKHFPGYGDAGDTH
TGFAQINKPWTNYENEDLLPFKAGIKAGADGIMVSHIVIKNLDSNLPASLSPAVHKLLRY
KLKYNGLIITDDLQMGAITDYAKEHHTNADLLALKAGNDMLLGGNYQTGISIIKRAVQNG
SISKKQIDRSVRRVLLLKEKLGILK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaaacattattttttattacattagcaagtgcaatattattagttactgga
tgtagtcatgaggtcaaaaaggtgtctaagtcttctaataaaaccagtcaagtggctaag
ccaaagaagaaaactaaaaagccagatcgaattaaacaaattatgagtaaaatgacgcta
gatgaaaaaatcggtcaattatattttgctcatagtactggtaatttttcgcagatgaaa
cataatgttaataagtatcatttaggtggcacaacgcttttcgcacctgatttcaaaaat
aaatcaaaagtgcaatttatccaggaaatgagagaataccaatcatcgagtaatcacggc
ttgttaattgcaactgatcaagaaggcggtacggtcacccgaattgacagcaatcctaag
atttcttctagaaagtatcctagcccacaagaagtttacaactcacatggtctacaagga
attcaaaaagaagacagtgaagtggcgcatattctccaccaaaacggaattaacatgaat
ttcgcacctgtggctgatgttgccaagaataaaaatagctttatctacaatcgaacttta
ggtcaaaattatgagataactgctaaatatattcctgttgcagtaaaggcgatccagagt
caaaaagtagctagttgtttgaaacatttcccaggttatggtgatgcaggtgatactcat
accggttttgctcaaatcaacaagccttggactaactacgaaaatgaagatttgttaccg
tttaaagctggcattaaagcaggagcagatgggattatggtctcacatatcgtaattaag
aatctagattccaatttaccagcatccctctccccagccgtacataaattgctacgctac
aagttaaaatacaatggtttaatcattaccgatgatctacaaatgggggctattactgat
tatgccaaagaacatcatactaatgctgatcttttagcactaaaggctggtaatgatatg
ttacttggtggcaattatcaaacaggtatttccatcattaaacgtgcagttcagaatgga
tcgatcagtaaaaagcaaattgatcgctctgttagaagagttctattgttgaaagaaaaa
ttaggtattttaaaataa

DBGET integrated database retrieval system