KEGG   Lactobacillus kefiranofaciens: WANG_0911Help
Entry
WANG_0911         CDS       T01526                                 

Gene name
murE1
Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lke00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lke00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
988584..989936
Genome map
AA seq 450 aa AA seqDB search
MSFKSGIAKIAGKSSYWFLHNVLKGGTSFPGKLAMKIDPAVLNSLAKGYETVIVTGTNGK
TMTTALIVEALRKKYGDVLTNPSGSNMQQGIVTAFLAHKHKRVKRKIAVLEVDEANVKMV
TKLLHPSVFVLTNIFRDQMDRYGEIYTTYDKIVNGIKLAPEATIIANGDASIFSSVELPN
KKIFYGFKLADDQPANDFKAPVNTDGVLCPKCDHILHYHERIYANLGDFFCPNCGYHRPD
LTFTVNKIVDQTPNSLKFQMGNKQYSINIGGTYNIYNALAAYSVARHFGLTEAEVAQAFA
ENKRIFGRQELIHYGGKDIDLILVKNPVGLDEVLHMLNTEKDDYSLVALLNANHADGIDT
SWIWDADFEGLDRSKIKKVLVGGQRWHDMGFRLEISGFDPGTMSTNPDDDSLIEEIKKLP
TKKVYILSTYTAMLALRKKMAEKKIIKAGM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaatcaggaatcgctaaaattgccggaaaatccagttactggttcttgcat
aacgtcttaaagggcggcacaagttttcccggtaaattagcaatgaaaattgatccggca
gtccttaactctttagctaagggttatgaaacagttatcgttactggaaccaacggtaag
acaatgacaactgcattaattgttgaagccttaagaaaaaaatatggcgacgtattaacc
aacccttctggctcaaatatgcagcaaggaattgttactgcctttttggctcataaacat
aaacgagttaaacgcaaaattgcggttctagaagttgacgaagccaacgtaaagatggtt
actaaattgctccatcctagtgtctttgttttaactaatatttttcgggatcaaatggac
cgctacggtgaaatctatactacttatgacaaaattgtaaacggaattaagttagcacct
gaggcaacaattatcgccaatggtgatgcaagcattttttcttcggtagaattgcctaat
aaaaagattttctatggtttcaagttagctgatgatcaaccagctaatgattttaaggct
ccagtgaataccgatggtgtcctttgtcctaagtgcgaccatattttgcattatcatgaa
cgcatctatgccaacttaggtgatttcttctgtcctaactgcggctatcatcgccctgat
ttaacctttacagtgaataaaattgttgatcaaacccctaacagcctaaaattccaaatg
ggcaataagcaatactccattaatattggcggtacttacaatatttacaatgctttagct
gcttactccgttgcccgtcactttggtttaactgaggcggaggttgcccaagcatttgct
gaaaataaacggatttttggtcggcaagaattaattcattatggcggtaaagacatcgac
ctaatcttggttaaaaatccagttggacttgatgaagtattgcacatgctcaatactgaa
aaagatgattattcactagttgctttgcttaacgctaatcatgctgatgggattgatact
tcttggatctgggatgcagattttgaaggattagatcgcagcaagattaaaaaggtcctt
gtcggcggtcaacgctggcatgatatgggctttagactggaaatttctggctttgatcct
ggaacaatgagtactaatccagacgatgatagtctaatcgaagaaattaagaaattacca
accaaaaaggtctacattctttcaacttatactgcaatgttagcgttaagaaagaaaatg
gcagaaaagaaaattattaaagctggtatgtag

DBGET integrated database retrieval system