KEGG   Lactobacillus kefiranofaciens: WANG_0951Help
Entry
WANG_0951         CDS       T01526                                 

Gene name
tpiA
Definition
(RefSeq) Triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WANG_0951 (tpiA)
   01230 Biosynthesis of amino acids
    WANG_0951 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WANG_0951 (tpiA)
   00051 Fructose and mannose metabolism
    WANG_0951 (tpiA)
   00562 Inositol phosphate metabolism
    WANG_0951 (tpiA)
Enzymes [BR:lke01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WANG_0951 (tpiA)
Exosome [BR:lke04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WANG_0951 (tpiA)
  Exosomal proteins of bladder cancer cells
   WANG_0951 (tpiA)
  Exosomal proteins of melanoma cells
   WANG_0951 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1033663..1034421)
Genome map
AA seq 252 aa AA seqDB search
MSRTPIIAGNWKLHMNPEQTTEFVDAVKDKLPDPSKVESLICAPAVDLDALRKAAKGSNL
HIGAENCYFEDEGAFTGETSPKVLKEMGMDYVIIGHSERRGYFHETDEDINKKAKAIFAN
GLKPIICCGESLETREANKQEDWVVGQIKAALDGLTADQVSSLVIAYEPIWAIGTGKTAS
SDQAEEMCKTIRETVKDLYNEETAENVRIQYGGSVKPANVKELMSKPDIDGGLVGGASLK
PESYLELVNYQG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtacaccaattattgctggtaactggaagttacacatgaatcctgaacaaact
actgaatttgtagatgctgttaaggataagttaccagacccaagtaaggtagaatcactt
atttgtgcacctgcagttgaccttgatgctttgagaaaagctgctaagggttcaaactta
catatcggtgcagaaaactgttactttgaagacgaaggtgctttcactggtgaaacttca
cctaaggtcttaaaagaaatgggtatggactatgtaattattggtcactcagaacgtcgt
ggctacttccacgaaactgacgaagacattaacaagaaggctaaagcaatctttgctaat
ggcttgaagccaatcatttgctgtggtgaatcacttgaaactcgtgaagctaacaagcaa
gaagactgggttgttggtcaaattaaggctgctttagatggtcttactgctgatcaagta
tcttcacttgttattgcttacgaaccaatctgggctattggtactggcaagactgcttca
tcagatcaagctgaagaaatgtgcaagactattcgtgaaactgttaaggacttgtacaat
gaagaaactgcagaaaacgttcgtattcaatacggtggttctgtaaaaccagctaacgtt
aaggaattaatgtcaaagcctgacattgacggtggcttagttggtggtgcttcacttaag
cctgaatcatacttagaattggtaaactaccaaggctaa

DBGET integrated database retrieval system