KEGG   Lactobacillus kefiranofaciens: WANG_1306Help
Entry
WANG_1306         CDS       T01526                                 

Gene name
gmk2
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
lke00230  Purine metabolism
lke01100  Metabolic pathways
Module
lke_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    WANG_1306 (gmk2)
Enzymes [BR:lke01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     WANG_1306 (gmk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 AAA_33 ABC_tran AAA_24 AAA_17 AAA Rad17 AAA_5 AAA_14 AAA_28 PRK AAA_23 NTPase_1 AAA_29 T2SSE ATPase RNA_helicase SRPRB RsgA_GTPase Zeta_toxin Cytidylate_kin AAA_19 PduV-EutP APS_kinase DUF4923 MMR_HSR1 AAA_30
Motif
Other DBs
NCBI-ProteinID: AEG41001
Position
complement(1462824..1463369)
Genome map
AA seq 181 aa AA seqDB search
MKKIILIAGPSGTGKTTISDYLTEKYNIPRVLTHTTRPMRLGEKQNVSYHFETDETFSKL
HFFEHIRYGSYQYGSSREALNLAWKKSNLVSLIVDIKGVYTYVKQLGDKVYFLYVTTSTK
DELRERLLKRGDDPAKIQERLSGSELNLLPADLKNYAHVLVNDDLTQTKKALDALVAKLR
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataattttaattgcggggccaagtggtaccggcaagacgacaatttcagat
tatttaactgaaaaatacaacattccacgcgtgctcacgcatactactcgccccatgcgc
ttaggtgaaaagcaaaacgtgtcgtatcattttgagactgatgagacctttagtaagttg
catttctttgaacacattagatatgggtcatatcagtatggttcgagtcgcgaggcattg
aatctagcttggaagaagagcaatttggtgtctttaatcgtagatattaagggcgtctac
acttatgtgaaacagttgggcgacaaggtatatttcttatatgtcaccacttcgactaag
gatgaattgcgggagcgcctgcttaagcgcggggatgatccggcaaagattcaggaaaga
ctcagtggcagtgaattaaatctcttgccagctgacttgaaaaattacgcgcatgtatta
gttaacgatgatcttactcaaacaaagaaagcgcttgatgccttggtagcaaagctccgc
ggctaa

DBGET integrated database retrieval system