KEGG   Lactobacillus kefiranofaciens: WANG_1306Help
Entry
WANG_1306         CDS       T01526                                 

Gene name
gmk2
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lke00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1462824..1463369)
Genome map
AA seq 181 aa AA seqDB search
MKKIILIAGPSGTGKTTISDYLTEKYNIPRVLTHTTRPMRLGEKQNVSYHFETDETFSKL
HFFEHIRYGSYQYGSSREALNLAWKKSNLVSLIVDIKGVYTYVKQLGDKVYFLYVTTSTK
DELRERLLKRGDDPAKIQERLSGSELNLLPADLKNYAHVLVNDDLTQTKKALDALVAKLR
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaataattttaattgcggggccaagtggtaccggcaagacgacaatttcagat
tatttaactgaaaaatacaacattccacgcgtgctcacgcatactactcgccccatgcgc
ttaggtgaaaagcaaaacgtgtcgtatcattttgagactgatgagacctttagtaagttg
catttctttgaacacattagatatgggtcatatcagtatggttcgagtcgcgaggcattg
aatctagcttggaagaagagcaatttggtgtctttaatcgtagatattaagggcgtctac
acttatgtgaaacagttgggcgacaaggtatatttcttatatgtcaccacttcgactaag
gatgaattgcgggagcgcctgcttaagcgcggggatgatccggcaaagattcaggaaaga
ctcagtggcagtgaattaaatctcttgccagctgacttgaaaaattacgcgcatgtatta
gttaacgatgatcttactcaaacaaagaaagcgcttgatgccttggtagcaaagctccgc
ggctaa

DBGET integrated database retrieval system