KEGG   Lactobacillus kefiranofaciens: WANG_1713Help
Entry
WANG_1713         CDS       T01526                                 

Gene name
asnH
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WANG_1713 (asnH)
Enzymes [BR:lke01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     WANG_1713 (asnH)
Peptidases [BR:lke01002]
 Cysteine Peptidases
  Family C44
   WANG_1713 (asnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1901652..1903601
Genome map
AA seq 649 aa AA seqDB search
MCGIVAFYDPKINEKQAVIGKMMATIKHRGPGSDGYYTNDEVALGFRRLSIIDLQGGSQP
IYNEDKTRAIIFNGEIYNFKPLREELIKAGHVFTTQADTEVLLHGYEEWGMDGLLKRVRG
MFAFLIWDDNNKTLYGARDFFGIKPMYYSNQDGHLLVGSELKSFLEFPKFKRELNVEAVK
PYLMNQYNDLEETFFKGVYRFPAGHWFEYKNGEMKTHQYWDAEYKENSLSFEETLKRIND
DLKETVDLYRNADVKVGAFLSEGIDSSYLTSLLNPDDVFSVSFDDSTYDEASKAKALADI
NHWKFFSDKVDADEAMRDFPEMQYHMDEPDANPSIIPLWYLCKLARKHVTVALSGEGADE
LFAGYVNYGMHTHNNVIKIFTSELKKLPKKKQVKLAHKIKKMPNFPGKVHLYTNLAEPSE
FYVGQSVIYDMDYPTIFTSKDANSILQPTYRNKLTVNGIYQKDFKKVKGIDNVKQMQYID
LHHFMINDIEQKADKISMAHSLEVRVPYLDKKIAELANSIPTKYLVNRHDTKYALRKASE
KVLPDEWARRPKLGFPTPIKQWLKEPRFYKQVRSLFEEEFVNDIFDQKKIIKLLDDNYEG
DGSHRRQIWAIYTFLVWYKLFFVDYENTVKKYQHVQPEVASLIKQGKLL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcgcattttatgatccaaagataaatgaaaaacaagccgtaatcggt
aagatgatggctacgatcaagcaccgtggacctggctccgacggttactacactaatgat
gaggttgcactaggctttagaagattatcgattatcgaccttcaaggcggcagtcagcct
atttataatgaagataaaacaagagcaattatttttaatggtgaaatctataacttcaag
ccattaagagaagaattaattaaagcagggcatgtatttaccacgcaagctgatactgaa
gtattgcttcacggctatgaagaatggggaatggatggcctgcttaagcgcgttcgcggg
atgtttgctttcctgatctgggatgacaacaataagaccctttatggtgcgcgcgacttc
tttggcattaagccaatgtactacagcaatcaagatggacacttattagttggctcagaa
ttaaagagcttcttagaatttccgaagtttaagcgtgaattgaatgtagaagcagttaag
ccatatttgatgaaccaatataacgacttggaagagaccttcttcaagggtgtttatcgt
ttccctgcaggacactggttcgaatataagaatggcgagatgaagacgcaccaatactgg
gacgctgaatataaagagaacagcttgagctttgaagaaacgttgaagcggatcaacgat
gacttgaaggaaaccgttgatttgtatagaaacgccgatgttaaggttggggctttctta
tcagaagggattgactcatcatacttgacgagtttgttaaaccctgatgatgttttttct
gtcagcttcgatgactcaacttatgatgaggcttccaaggctaaggctttggctgatatc
aaccattggaagttctttagcgataaggttgatgctgatgaagccatgcgtgacttccca
gagatgcaatatcacatggatgaaccggatgccaatccatcaattattcctttatggtac
ctgtgtaagttggctcgtaagcatgttactgtggccctatctggtgaaggggccgatgaa
ttgtttgcaggctatgtcaactacgggatgcacacgcacaataatgtcatcaagatcttt
actagtgaactcaagaagctgcctaagaagaagcaagtgaaattggcacacaagattaaa
aagatgccgaacttcccaggtaaggtgcatctgtataccaatttggctgaaccaagcgaa
ttttacgttggtcaatcagtgatctatgacatggattatccgacgatcttcacttctaaa
gatgctaacagcatcttgcagccaacttaccgcaataagttaacggttaacggtatttac
caaaaggacttcaagaaggttaagggcatcgataacgttaagcaaatgcaatatatcgac
ttgcatcacttcatgattaacgatatcgaacaaaaagctgacaagatttctatggcgcac
tcattagaagttcgtgtaccatatcttgataagaagatcgcggaattggctaactcaatt
ccaactaaatatttggttaaccgccatgacactaagtatgctttgcgtaaggcctcagag
aaggttttaccagatgaatgggctaggcgaccaaagcttggcttcccaacaccaatcaag
caatggctaaaggaaccacgtttttacaagcaagtccgcagcttatttgaagaagaattc
gtcaatgatatttttgatcaaaagaagatcattaaattgcttgacgataactatgaaggc
gatggctcacatagaagacaaatctgggctatctataccttcctagtttggtacaagttg
ttcttcgttgattatgaaaacacggttaagaagtaccagcacgttcaacctgaagttgct
agtttaattaaacaaggcaagttgctttaa

DBGET integrated database retrieval system