KEGG   Lactobacillus kefiranofaciens: WANG_1810Help
Entry
WANG_1810         CDS       T01526                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lke  Lactobacillus kefiranofaciens
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lke00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WANG_1810 (gpmA)
   01230 Biosynthesis of amino acids
    WANG_1810 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WANG_1810 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    WANG_1810 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WANG_1810 (gpmA)
Enzymes [BR:lke01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     WANG_1810 (gpmA)
Exosome [BR:lke04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   WANG_1810 (gpmA)
  Exosomal proteins of melanoma cells
   WANG_1810 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000119..2000811
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESGQLWIPEMKTWRLNERHYGALQGLNKKKTAEKYGDEQVHIWRRSYDIL
PPAIDDDNEFSQAHDRRYANLDPHIVPKCENLHVCLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMNLEMKTGEPVVYTFDENLDVVKKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattagttttaattcgtcacggacaaagtgaatggaacctttcaaaccaattt
actggttgggttgacgttaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaatcaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcattggaagaaagtggccaactttggattccagaaatg
aagacctggagacttaacgaacgtcactacggtgctttacaaggtttgaacaagaagaag
actgctgaaaagtacggtgatgaacaagttcacatttggcgtcgttcatacgatattttg
ccaccagctattgatgatgacaacgaattcagtcaagcacatgaccgtcgttacgcaaac
ttggacccacacatcgtgcctaagtgcgaaaacttgcatgtatgtcttgaccgtgtaatg
ccattctgggaagatcacattgctccagacttacttgacggcaagaacgtaattatcgca
gctcacggtaactcacttcgtgctttgaccaagtacatcgaaaacatttctgacgacgac
atcatgaaccttgaaatgaagaccggtgaaccagttgtttacaccttcgacgagaactta
gatgttgttaagaaggaaaagttagacgactaa

DBGET integrated database retrieval system