KEGG   Leuconostoc kimchii: LKI_00730Help
Entry
LKI_00730         CDS       T01233                                 

Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lki  Leuconostoc kimchii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LKI_00730
  Lipid metabolism
   00600 Sphingolipid metabolism
    LKI_00730
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LKI_00730
Enzymes [BR:lki01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LKI_00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(126363..129425)
Genome map
AA seq 1020 aa AA seqDB search
MIQTLSETLKRRDWEQLGVTSINRLAMHSPLNYWSATEKPTYGHYSDAQTNLNGEWHFSA
FKRPEDVPESWLRAPMQSSQTITVPGNWQLQGQYDMPIYTNVSYPFPINPPFVPEQNPTG
AYSREFDISAEWLYDDGEVHLTFEAVSSAYYVWLNGNFIGYSEDSRLPSEFDVSQAVVVG
ENKLNVLVFRWSKGSYLEDQDMWRLSGIFRDVVLSHVPRVRLLDYHVTPTIDDDFDTAIV
KVETISTVGSRVKADLFWDNDIIASQTGTPGQVIVDERGADEQSLTINLVVQQPYLWSDE
IPNLYELVLTVYDDHQNMMHIEHTQVGIRRVAIENGLLKLNGQPLLIRGVNKHEFHPEKG
YAIDEATMRQDLMLLKQNNFNAVRLSHYPNHQRWYELANEYGILLVDEANIETHGMTPMN
HLTNDVRYLPQMTERVTRMVKRDRNFPAIIIWSLGNESGYGGNHDALYQWLKKNDPSRPV
QYEGGGADTAVTDIIAPMYARVDDDQIFDVNSKWSIKHWIGNPGETRPLILCEYAHDMGN
SLGGFNKYWHAFRQFDRLQGGFIWDWVDQGLSKDGDYAYGGDFNDSPNDRQFCLDGLLFP
DRTPKPAMYEVAYQQQYLQFKLQNLTLQVRSEYNFKHVNDQELRYTLVNNDKILVEKTVN
LTIAPLNTQVISLALPNVKLLTGRTYLNVTTIQSQDSGVFKVGDLRAYHQFVLKQGSNVL
QQPEHTTDAPKVSQTDQSIKITAGVTVWQFNLKTGLLTHWVVAGNDKILSPLRDNFTRAP
IDNDIGVSEIEKPDPNAWQARWLANGWFDLQEKLMAFHIAKSESHIEITTQHDYFAHDEH
VISSVKRYRFSQTGEMYISVDITCHTNGLPPARIGLQVMVPTFENVTYHGRGPFENYPDR
KSAAMLGSWHLAVQDFYTPYIFPSENGLRTDVTDIILNHQKITAHQTPISFQVSRFSQNE
LMQKIHRQELTADEGIWINLDGFHMGVGGDDSWSPSVAEAYLLNSSQYHYELTWKELADD
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaccttatcagaaacgttgaaacgccgtgattgggaacagttgggcgtgaca
agtataaatcgattagcgatgcactcgcccttaaattactggtctgcgacagaaaaacct
acctatggtcactatagcgatgcacaaactaatttgaatggtgaatggcacttcagtgca
tttaagagacctgaagatgtgccggaaagttggttacgtgcgccgatgcaaagtagtcaa
actatcacggttccgggaaattggcagttgcaaggccagtatgatatgccaatttacaca
aatgtgtcctatccatttccaattaacccaccttttgttccagaacaaaatccgaccggt
gcgtatagtcgtgaatttgatatatcagcagaatggctatacgatgatggtgaagttcat
ttaacgtttgaggcggtgtcatcagcttattatgtttggttaaatggaaattttataggg
tattccgaggacagccgcttaccatcagagtttgatgtcagtcaagctgtggttgtcggt
gaaaataaattaaacgtattggtgtttcgttggagcaagggtagttatttagaagatcaa
gatatgtggcgtttatctggcatatttagggatgtcgttttatcccatgtacctcgtgtc
cgtctattagattatcacgtaacaccaacgattgacgatgattttgatacagcaattgtt
aaagttgaaacaataagtacggtaggatctagagttaaagcggatttgttttgggacaat
gatattattgcttcccagactggcacacctggacaggtgatagttgatgaacgtggtgct
gatgaacagtcattgacgatcaacttagtagtgcaacaaccatatttatggtcagatgaa
atacctaatttatatgaattagtgctgacagtttatgatgaccatcaaaatatgatgcat
attgaacatacacaagtcggtattcgtcgcgtcgcgattgaaaacggtttactcaaactg
aatggtcagccattactgattcgcggtgttaataaacatgaatttcatcctgaaaaaggc
tacgcaattgatgaagctaccatgcgacaagatttgatgttgttaaaacagaataatttt
aatgcggtgcgtttatcccattatcctaaccatcaacgttggtatgaactagcaaatgaa
tacggcattttgttggtagatgaggccaatattgaaacacatggcatgacacccatgaat
catttaaccaatgatgtgcgttatttgccccaaatgacagaacgcgtaacgcgtatggtg
aaacgtgaccgtaattttccggctattattatttggtcattgggcaatgagtcaggctac
gggggtaaccatgatgcgttatatcaatggcttaaaaagaacgaccctagtcgcccagtt
caatatgaaggtggtggcgctgatacagcagtcactgatatcattgcgccaatgtatgcg
cgtgttgatgatgatcaaattttcgacgttaattctaaatggtcgattaaacattggatt
ggcaatcctggtgaaacgcgaccactgattttatgtgagtacgctcatgatatgggtaat
agtttgggtggttttaataaatattggcacgcttttcgacaatttgaccggttacaagga
ggatttatttgggattgggttgatcaaggattgtctaaagacggtgattacgcgtatggt
ggcgattttaacgacagtcctaatgaccgacaattttgcctagatgggctcttattccca
gaccgtacaccaaaacccgctatgtacgaggttgcctaccaacagcaatatttgcaattc
aaacttcaaaatttgacattacaggttagaagtgaatacaatttcaaacatgtcaacgat
caagagttgcgatatacgttggttaataatgataagattcttgttgaaaaaaccgttaat
ctaactattgcgccgttaaatacacaagtcatatcgttggcattaccaaatgtgaaattg
ctaaccggccgcacatatcttaacgtgacaacaatacaatctcaagatagtggtgtattc
aaagttggtgatttacgggcatatcatcagtttgttttaaagcaaggaagcaatgtgcta
caacaaccagaacacacgacagacgcacctaaagtgtcacaaacagatcaatcaatcaaa
attacggccggcgtaactgtatggcaatttaatttaaaaacaggattgttgactcattgg
gtagtagctggaaatgacaaaattttatcaccattacgtgataattttacacgtgcaccg
attgacaatgatattggggttagtgaaattgaaaaaccagaccccaatgcttggcaagcg
cgttggttagcaaatggctggtttgacctgcaggagaaattaatggcttttcatattgcc
aaatcagaatcgcatattgaaatcacaacgcaacacgattattttgctcatgacgaacat
gtcatatcatctgtcaaacgttatcgatttagccagacaggtgagatgtacattagtgtt
gatatcacatgtcatacaaatggtttgccaccggcccgcatagggttacaagttatggtc
ccaacatttgaaaatgttacttatcacggtcgcggtccatttgaaaattatcctgatcgt
aaaagtgctgctatgctaggttcttggcatttggcagtgcaagatttctataccccttac
atttttcctagtgagaatggtcttcgcacagatgttactgacattattttaaatcatcaa
aaaattacggcacatcaaacgcccatatcgtttcaagtcagtcgttttagtcaaaatgaa
ttgatgcaaaaaatacatcggcaagaattgacggctgacgaaggtatttggattaactta
gatggttttcatatgggagtcggcggggatgattcgtggtctccaagtgttgcagaagca
tatttgttaaatagcagtcagtatcactatgaactgacttggaaggaattggcagatgat
taa

DBGET integrated database retrieval system