KEGG   Leuconostoc kimchii: LKI_00770Help
Entry
LKI_00770         CDS       T01233                                 

Definition
(GenBank) hypothetical protein
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lki  Leuconostoc kimchii
Pathway
lki00300  Lysine biosynthesis
lki01100  Metabolic pathways
lki01120  Microbial metabolism in diverse environments
lki01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LKI_00770
Enzymes [BR:lki01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LKI_00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADG39697
UniProt: D5T098
Position
complement(136298..137542)
Genome map
AA seq 414 aa AA seqDB search
MNEDDMLLRQLVNINTAGRNELEVANYLQQLFKAHNIQNEIVPLSAGRSGIIATIGNGKG
PTIAFDGHEDTVAIGDVTRWHVEPLAGTIVDDKFYGRGITDMKAGLAAGVAAMIRLKKKE
DLLHGTFKLFATVGEESGEIGAKQMVELGLANNIDALLVGEPSGIPLDSVENIPKGTALP
GIMLSEDIHEVVKTNHTNEQHFLTVAHKGALTYKVKSLGVTAHSSMPDLGVNAIDALVDF
INQQSQVFQTISQVKNDILGVTTPVVTEISGGEQPNTVPGNAEVNVFIRTIPEVTHEEII
NQISNIIKHINQTGHAKLSLEVGLELDAVYSSTTSKLSQLAKRIGERILDQSLPYIGVSG
GTDASQFLKTNPNLGFLIFGPGNTTAHQVDEFVYTDMYHSFINIYEEIIQNYLQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagatgacatgttgctacgtcaacttgttaatataaacacggctgggagaaat
gaattagaagtcgcaaattatttacagcaactatttaaagcacacaatattcaaaacgaa
atcgtgccactttctgctggccgttcgggtattatcgcaactattggcaacggaaagggt
ccgacaattgcctttgacgggcacgaggacacggtagctattggcgatgtaaccagatgg
catgtagagccacttgccggtacgattgtcgatgataaattttatggtcgcggtatcact
gatatgaaagcaggtctcgctgcaggtgtagcagctatgatacggttaaaaaagaaggaa
gacttgttacatggtactttcaaattatttgctactgttggtgaagagtcgggtgaaata
ggcgcaaagcaaatggtcgaattaggtttagcaaataatattgatgctttactagttggt
gaaccaagtggcataccgttagattctgtagaaaatatacctaagggaacagcattaccg
ggcatcatgttgtcagaggatattcatgaagtcgtgaaaacaaatcatactaatgaacaa
cattttcttactgttgcccataaaggcgcgttaacttataaagtcaaaagtttaggcgtg
acagcacatagttcaatgcccgatttaggcgtcaatgctattgatgcattagttgatttt
attaatcaacaaagtcaggtatttcaaacaatttcacaggttaaaaatgatatattaggt
gtcacaacacctgtagtaacagaaataagtggtggtgaacaacctaatacggtgccaggt
aacgctgaagtgaatgtgttcattagaacaataccagaagtgacccacgaagaaatcatc
aatcaaatatcaaacattatcaagcacattaatcaaacaggtcatgcgaaactgtcatta
gaggtaggacttgaattggatgctgtttattcatcaacaacatctaagttaagccaacta
gcgaaacgtattggtgaacgtattttagaccaatcattaccttatatcggtgtttctggg
ggcacggatgcttctcaatttctgaaaacgaatcctaatttagggtttttaatatttgga
cctggtaacacaacagctcatcaagttgatgaatttgtatataccgatatgtatcattct
tttattaatatttatgaggaaattattcaaaattacttacaataa

DBGET integrated database retrieval system