KEGG   Leuconostoc kimchii: LKI_01050Help
Entry
LKI_01050         CDS       T01233                                 

Definition
(GenBank) GTP cyclohydrolase I
Organism
lki  Leuconostoc kimchii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(189482..190057)
Genome map
AA seq 191 aa AA seqDB search
MTMFNDEKTTTLMQGVTNLLRVIGDDDKREGLIETPMRVVKAQAEIFAHTGEAQFDDFKL
FSTTNDADMVIVESIPFYSMCEHHLLPFFGTVDVAYVPDGQIIGLSKIPRLIEWASRRPN
VQENLTHLIASEMNRIVAPKGVAVNVTARHMCMEMRGINQPGTQTNTAIYRGLLQTDTFL
KESFTHRVNKH
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgtttaacgatgaaaaaaccacaactttaatgcaaggtgtcaccaatctatta
agagtgattggtgatgatgacaagcgcgagggattaattgagacgcccatgcgtgttgtt
aaagcgcaagctgaaatttttgcgcacactggcgaggcgcaatttgatgattttaaatta
ttcagcactacaaatgatgctgacatggtcattgttgaaagcataccattttattccatg
tgtgaacatcatttattgcctttttttgggacagtagatgttgcttatgtccctgatggt
caaattattggtctgagtaaaataccgcgattgattgaatgggctagtcgccgaccgaat
gtccaagaaaatttaacgcacttaattgccagtgaaatgaatcgtattgttgcgcccaag
ggtgtagcagtaaatgttacggctaggcatatgtgtatggaaatgcgtgggatcaaccaa
ccagggacacagactaacacagcaatttatcgtggtctactacagacagatacattttta
aaggaaagttttacacatcgtgtaaacaaacactaa

DBGET integrated database retrieval system