KEGG   Leuconostoc kimchii: LKI_01055Help
Entry
LKI_01055         CDS       T01233                                 

Definition
GTP cyclohydrolase I
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lki  Leuconostoc kimchii
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LKI_01055
Enzymes [BR:lki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     LKI_01055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(190044..190544)
Genome map
AA seq 166 aa AA seqDB search
MTVAYLSLGANIGDRLANLQQAVTLLQETIGIDVTDISNVYETQPVGGVVQDDFYNLALR
VDTNLSVLELLARLHEIESRLKRVRKVHWGPRTIDIDILVFGDDVWSDDTLTVPHREMAN
RRFVLTPLLDVVSDDRRYEIENLLAHTTDTNWVRVVANVRVENDNV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcttatttaagtttaggtgctaatattggggatcgactggctaatttgcaa
caagcagtgacgctattacaggaaactatagggatagacgttactgatatttcaaatgtt
tatgagacgcaaccagtaggtggtgtggttcaggatgatttttataatttagctttgcgg
gtggatactaatttatcagtccttgaattattagcgcgtttacatgaaattgaatctcgt
ttaaaacgcgttcgtaaagtccattggggaccgcgtacaattgatattgatattttagta
tttggggatgatgtgtggtcagacgatactttgaccgttccacatcgtgagatggcgaat
cgtcggtttgtactgacgcctttgttagatgtcgtgtcggatgatcggcgctacgaaatt
gaaaatttattagcgcatacaacggatacaaattgggttcgtgttgtggctaatgtgaga
gtagaaaatgacaatgtttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system