KEGG   Leuconostoc kimchii: LKI_01090Help
Entry
LKI_01090         CDS       T01233                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lki  Leuconostoc kimchii
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LKI_01090
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LKI_01090
Enzymes [BR:lki01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LKI_01090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(195385..196173)
Genome map
AA seq 262 aa AA seqDB search
MILDELVHVTRENMLTRQREVSLSDLKAKAEQMLVYTDFPVEQALQQPQISVIAEIKQAS
PSKGQIIPTNQFDYMAIARQYELASVDLVSVLTEETYFKGSLNILKSVAKAIDTPVLRKD
FTIDPYMIYEAKVAGASAILLIVAILDDVQLNQYLHLADQLGLSAIVEAHTASEIKRAIA
AKARIIGINNRNLKDFTVDFDNTARLRALVPEGVSVVSESGIRSREDVTLLENINVNGIL
IGETFMKAKDKINMFNILTGRE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaattagtacatgttacacgcgagaatatgttgaccagacaacgtgag
gtatctttatcagatttaaaagcaaaagcagaacaaatgttggtctataccgattttcct
gttgagcaggccttacagcaaccacaaatttctgttatagcagaaattaaacaagcgtca
ccctcaaaaggtcaaattataccaactaatcaatttgattatatggcaattgctcgtcag
tatgagttagcgagtgttgatttagtcagcgttttaacggaagaaacttatttcaaagga
tcattgaatattttgaaatcggtcgcaaaagcaattgatacccctgtactacgcaaagat
ttcacaattgatccctatatgatttacgaagcaaaagttgccggagcatctgctattcta
ttaattgtagctattttggacgacgtgcaattaaatcagtatcttcatttagctgatcaa
ttagggttatcagccattgttgaagcacatactgcttcagaaattaagcgtgccattgct
gcaaaagcgcgtattattggcattaataatcgtaacctcaaagattttacggtggatttt
gataatacagcacgtttacgtgcattggtccctgaaggcgtcagtgttgtctctgagtcg
ggcattcgatcacgtgaagatgtgacattacttgaaaatatcaacgtcaatggcatcttg
attggtgaaactttcatgaaagcaaaagataaaattaatatgtttaacattttaacagga
cgtgaatga

DBGET integrated database retrieval system