KEGG   Leuconostoc kimchii: LKI_01100Help
Entry
LKI_01100         CDS       T01233                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lki  Leuconostoc kimchii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LKI_01100
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LKI_01100
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LKI_01100
Enzymes [BR:lki01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LKI_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(197188..198375)
Genome map
AA seq 395 aa AA seqDB search
MIKKGYYGEYGGQFIPELLMPAVSAVADAFNHYKDDAAFKDELKDLFDNYANRPSLLYHA
KNMSKDLGGAQIYFKREDLNHTGAHKINNVLGQALIAQRMGKTRLIAETGAGQHGVATAT
AAALFGMEAEIFMGKEDTDRQALNVYRMELLGAKVHVVDTGTMVLKDAVNATFQEWTKRI
DDTFYVLGSAVGPYPFPEMVKYFQSIISEEAREQFLSQTGKLPDAVIAAVGGGSNAIGAF
SKFISDRDVALIGVEAAGKGIHTTQTAATITNGSQGIFHGMKSKFLQSPDGQIDPVYSIS
AGLDYPGIGPEHAYLSDIKRAQYVPITDDEAVQAFEYIARTEGIIAAIESSHAVAYAMKI
APNMKPDQQIMVNLSGRGDKDVAAIARYKGVEINE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaggttactatggcgagtatggtggacagtttattcctgaattattaatg
cctgctgtgagtgctgttgctgatgcatttaatcattacaaagatgatgcagcgtttaaa
gatgagttaaaagatctatttgataattatgctaatcgaccatctttgttgtatcatgct
aaaaacatgtccaaagatcttggcggcgcacaaatatattttaagcgtgaggatctcaat
catacaggtgcacataaaattaacaatgttttgggtcaggcgttaatcgcacagcgaatg
gggaagacaagattaatagctgaaactggagctgggcaacatggtgttgcaacggcgaca
gcggctgcattgtttggtatggaagctgaaattttcatgggtaaggaagacacagatcgt
caagcgctgaatgtctatcgaatggaactgttaggtgcgaaggttcacgtggtggacaca
ggcacaatggttttaaaagatgctgtgaatgcgacttttcaagaatggactaaacgaatt
gatgatacattttatgttttaggatcggcagttggcccttatccgttccctgaaatggtg
aagtactttcaatcgattattagtgaagaggctcgcgaacaatttctaagccaaactggt
aaattaccagatgctgttattgctgctgttggtggcggctcaaatgcgattggtgctttt
agcaaattcatctcagatcgagatgttgcattaatcggcgttgaggcggctggtaaggga
attcatacaacacaaactgcagcaacaattactaatggttcacaaggaatttttcacggt
atgaagtccaaatttttacagtccccagacggacaaattgatccagtttacagtatctca
gctggacttgattatccaggaattgggccggaacacgcctatttatctgacataaagcgt
gcgcaatatgtgcctattacagatgatgaggcagtgcaggcatttgagtatattgcacgc
acggagggaattatagcagcaattgagagttcacatgcggtggcctatgcaatgaaaata
gcgccaaacatgaagccagatcaacaaatcatggtcaatttaagtggtcgtggtgataaa
gatgttgccgccattgcacgatacaaaggagttgaaattaatgagtaa

DBGET integrated database retrieval system