KEGG   Leuconostoc kimchii: LKI_01320Help
Entry
LKI_01320         CDS       T01233                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lki  Leuconostoc kimchii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LKI_01320
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LKI_01320
Enzymes [BR:lki01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LKI_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(241070..242545)
Genome map
AA seq 491 aa AA seqDB search
MKLSSETIQQLLNDEHLLVSKPEVTQTFDFLHYDTRQVKANTLFVVKGAFRPEYLTQTDG
VSGLVTETRLDVSLPQWQVTDVQKALSILSMAFFGYPQHDLWIGAFTGTKGKTTAAYMAY
NILKNTTDKHVALFSTVDRITGNNSEDKKKSDLTTPESYELFKDMRRSVDNGMTHLVMEV
SSQAYLKQRVYGLRYNVGAFLNISPDHIGPNEHPTFEDYLAHKLMLFDHSDQVIINAESD
HLSEIMTHAKQTHDLVYTYSLAGKGGAYTYTSQESAIHESRLTVLPSDLKALAGHYRLNL
PGDFNESNAMAALIMSALAGASHDNMIRGLDEVFIPGRMLSLPISGHGVTFVDYAHNYAS
MHALLRFAQNQYPEGRVLVVVGSPGNKGVSRRADFGRVVSELADVVYLTADDPQFESPMV
IAKEIASHITSETLEVHFEMNRIQAINQAISQATEKDIVIVAGKGEDPYQKINGVDEPYI
GDYAVVKQYQN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatcaagcgaaacaattcaacagctattaaatgacgaacatttgttggtatct
aaaccagaagtaacacaaacgtttgattttttgcactatgatacgcgccaagttaaagca
aatacactctttgttgtcaagggtgcgtttcggccagaatatttaacgcagacagatggc
gtttctgggttagtaaccgagacacgtcttgatgtctccttgccacaatggcaagttaca
gatgtccaaaaggctttgtcaatattatccatggccttttttggttatcctcaacatgat
ttgtggattggtgcgtttactggaaccaaaggtaaaacaacagcagcgtatatggcgtac
aatattttgaaaaatacaacagataagcatgttgcattattttcaactgttgataggatt
acgggaaataattctgaagataagaaaaaatcggatttgacgacgccagaatcttatgag
ctatttaaagatatgcgccggtcagttgataatggtatgacacatttagttatggaagtc
agttctcaggcctatttaaagcagcgtgtttacggactaagatacaatgtaggcgcattt
ttaaatatttcaccagatcatatcgggccaaatgagcatccaacctttgaagattatcta
gcacataaattgatgctatttgatcattcagatcaagtgataattaatgctgaaagtgac
catttgagcgagattatgacacatgcaaaacaaacacatgatctagtttatacctatagt
ttagctggtaaaggtggtgcttatacctatacatcacaagaaagtgccattcacgaaagt
cgattaacagtcttaccgagtgacttaaaggcactagctgggcactatcgcttgaatttg
ccgggtgattttaacgagtcaaatgcgatggcagcattaattatgtcagctcttgcgggt
gcgagtcatgacaatatgattcgtggcttggatgaggtatttatacctggccgcatgttg
agcttaccaatttcaggacatggtgttacttttgttgactatgcgcacaattatgcctcc
atgcatgcgttgttacgttttgcgcaaaatcagtatcctgagggacgtgtattagttgtt
gttggatcaccaggtaataagggtgtttctcgtcgtgctgactttggtcgtgtggtatct
gaattggcagacgtggtctatttgacagctgatgatccacagtttgaatcaccaatggta
attgctaaagaaattgccagccatattactagcgaaacactagaagtccattttgagatg
aatcgtattcaggcaattaatcaggcgatttcacaggccacggaaaaggatattgtgatt
gttgctggtaagggtgaagatccatatcaaaagatcaatggtgttgatgagccctatatt
ggcgattatgcagttgtgaaacaatatcagaattaa

DBGET integrated database retrieval system