KEGG   Leuconostoc kimchii: LKI_01450Help
Entry
LKI_01450         CDS       T01233                                 

Definition
exodeoxyribonuclease V, alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lki  Leuconostoc kimchii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lki03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(272715..275102)
Genome map
AA seq 795 aa AA seqDB search
MTYQEQQLEKITGTLQNVIFASSDSYFKILSVQIDDSTLENWDETEIIATGTFADVQEGS
VYAFYGSVVRHPKYGQQFKVTRYENELPPDENGLIKYFTSGQFSGIGKKTATKIVEHLGL
NAVNLILDDVHVLDGIVKEPTAKKLMRSLQLNLGLERLFQVGSQFGMGADMAGRLYDQYG
SEAETILNQDPYRLVFEFDGMSFRMADMIGQKIGINRTNERRVQAAVYATITTMSYQYGH
TYLTREKLIQSSVKLIRDFNAEVIVSQAIDHLLADKILVEEDQCLYAATLYLSEIQTAND
LNRLLDASLPFKLSEQAIDDAFITPGQLVLDKTQIAAVKAGLNAQVFLLTGGPGTGKTTI
VRAVVATWHKLLQAQAKYADNTTDFLKSYAVKMASPTGRAAKRMTEVTGYDATTIHRLLG
ISDLDEPEFNADNPITGGLLVVDEASMLDIELTAKLLAAIPNGMKLMIVGDSDQLPSVGP
GNVLADLVDSGKIAHIELDTIYRQGRGSSITTLAQHIKRGELPTDFMENQQDRSTFMVSH
DQTDQAIKQVVQAAVKKGYTQDDLQILTPIYKTTSGVNALNTMAQELFNPAKPAQKSLQF
GTTIFRKGDKILQLENDSERDIYNGDMGKIIAVQYKNDKSNNDHEDRLIVDFDGKEMSYP
KKDLNQLTLAYATTVHKAQGNEFKVVVMALTTRFGLMLNRNLLYTGITRAKEALILVGEY
EAFLHAAQTPVPMRSTRLKARLQNQVVVSSQVSVNSPNVEPKAARNHLTVEMIQSNDISP
LIGLNGITPYDFMPS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgacatatcaagaacaacaattagaaaaaatcactggtacgttacaaaatgttattttt
gcatcgtcagattcttattttaaaatattatcggttcaaattgacgattcaacgctcgaa
aattgggatgaaacggaaattattgcaacaggtacgtttgctgatgtacaagaaggcagt
gtttatgctttttatggttcggttgttcggcatccaaagtatgggcaacagtttaaagtc
acgcgttatgaaaatgagttaccgcctgatgaaaatggtctaattaagtattttacgagt
ggccaattttctggtattggtaagaaaacagcaactaaaattgttgagcatctgggcttg
aatgctgttaaccttattttagacgatgtacacgtgttggatggtattgttaaagagccc
acggccaagaaattaatgcgaagtctacaattgaatttaggactagagcgattatttcaa
gttggtagccagttcggcatgggtgcagatatggcaggtcgtttatacgatcagtatggt
agtgaagcagaaacaattttgaatcaagatccttatcgccttgtgtttgagtttgatggc
atgtcatttagaatggcagatatgattggtcaaaaaattggtattaatcgtacaaatgaa
cggcgtgtgcaggctgcagtttacgctacaataacaacaatgagctatcagtatggtcat
acttatcttacacgtgaaaaactgatacaatcaagtgtcaagttaattcgagatttcaat
gctgaagtgattgtgtcacaagctattgatcacttgttggcagataaaatcttggtagaa
gaagatcaatgcctttatgctgctacgctatatctttcggaaattcaaactgctaatgat
ttgaatcgcttgttagatgctagtttaccatttaaattgtcagagcaggctattgatgat
gcatttataacacctgggcaactcgtattagataagacgcagattgctgcagttaaagct
ggattaaatgcgcaagttttcctattgactggtggtccaggcactggtaagacaacaatt
gtacgcgctgttgttgcgacttggcataaattgttgcaagcgcaagcaaaatatgctgat
aatacaacagactttttaaagtcctatgctgtaaaaatggcatcaccaacagggcgcgcc
gccaagcgtatgacggaagtcacaggttacgacgcgaccacgattcaccggttgctcgga
atatcagatttagatgaaccagaatttaatgccgataatcctattacaggcggcttactg
gtcgttgatgaagcttcaatgcttgatattgaattaacagcgaaattactagcggctata
ccaaatggcatgaaactcatgatagttggtgactcagaccaactaccttcagttggtcca
gggaacgtcttagctgatcttgtggatagtggtaaaatagcgcatattgagcttgatacc
atttatcgtcagggcaggggcagcagtattacaacactagcccaacatattaagcgtggt
gaattaccaacagatttcatggaaaaccagcaagatcgatcaacttttatggtgtcacat
gaccaaactgatcaagcgattaaacaagtcgttcaagcagccgttaaaaagggttatacg
caggatgatctacaaatattgacacctatttacaagacaacatcaggtgttaatgcactt
aataccatggctcaagaacttttcaacccagctaagccagcccaaaaatcactccaattt
gggacaacgatttttcgcaagggtgataaaatattacaattagaaaatgatagtgagcgt
gatatttataatggtgatatgggtaaaattattgctgtccaatataaaaatgataaaagc
aacaatgatcatgaagatcgtctaattgtagattttgatgggaaagagatgagttaccca
aaaaaggatcttaatcaattaactttggcgtatgccacgaccgttcataaagcccaaggt
aatgaatttaaagtcgttgttatggccttaactactagatttggactgatgcttaatcgt
aatttattatacactggtatcactcgggctaaagaggctttgattttagttggcgaatat
gaagcgtttcttcatgccgcgcaaacgcctgtgccgatgcgttcaacaagattaaaggca
cgattacaaaatcaagtggttgtgtcatctcaagtaagtgttaatagcccgaatgtcgaa
cccaaagcagctaggaatcatttaacagttgaaatgattcaatcaaatgatatttcacca
ttgattggtttaaatggcatcacgccttacgattttatgccaagttaa

DBGET integrated database retrieval system