KEGG   Leuconostoc kimchii: LKI_02590Help
Entry
LKI_02590         CDS       T01233                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lki  Leuconostoc kimchii
Pathway
lki00010  Glycolysis / Gluconeogenesis
lki00260  Glycine, serine and threonine metabolism
lki00680  Methane metabolism
lki01100  Metabolic pathways
lki01110  Biosynthesis of secondary metabolites
lki01120  Microbial metabolism in diverse environments
lki01130  Biosynthesis of antibiotics
lki01200  Carbon metabolism
lki01230  Biosynthesis of amino acids
Module
lki_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LKI_02590
  Energy metabolism
   00680 Methane metabolism
    LKI_02590
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LKI_02590
Enzymes [BR:lki01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LKI_02590
Membrane trafficking [BR:lki04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LKI_02590
Exosome [BR:lki04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LKI_02590
  Exosomal proteins of melanoma cells
   LKI_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADG40061
UniProt: D5T1B2
Position
complement(489633..490301)
Genome map
AA seq 222 aa AA seqDB search
MVTQLVLVRHGESTANRDNEFTGWTDVPLTLKGRQQAKKVGDILANHQLLFDDVHTSYLQ
RAITTANIILLEMNQSWLPVHKTWRLNERHYGALRGLNKDAARLKYGVDAVALWRRSYTA
VPPLLGKTVTDRRYPDSIEPHGESLQMASERLLPYWSTEILPGLKAGRNQLIVAHGSTLR
ALIKYLEAIADDDIDGLEIGNGEPICYTFNDQLQLGDRQYLR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtaacacagcttgtgttggttcgtcatggtgaatcaaccgctaatcgtgataatgaa
tttacaggttggacagatgtgcctttaacactaaaaggcagacaacaggctaaaaaggtg
ggggatattttggcaaaccatcagttgttgtttgatgatgtacatacctcatacttacaa
cgtgcgattacgacagctaacattatcttattagaaatgaatcaatcttggttacctgtc
cataaaacgtggcgacttaacgaacgtcactatggtgctttacgcggtctaaataaagat
gcggcacgattaaaatacggtgtggatgctgttgcattatggcgtagaagctatacggct
gtaccaccgctgttaggaaaaacagtaacagatagacgttatcccgatagtatagagcca
catggtgagagtttgcaaatggcgagcgagcgcctactgccttattggtcaactgagatt
ttacctggcttaaaggctggtcgtaaccagttaattgttgctcatggcagtacattgcgt
gcattgataaaatatttagaagcaattgctgatgatgatattgatggtctcgaaattggt
aatggtgagccaatttgttatacgtttaatgaccaattacagcttggtgatcgtcagtat
ttaaggtaa

DBGET integrated database retrieval system