KEGG   Leuconostoc kimchii: LKI_02995Help
Entry
LKI_02995         CDS       T01233                                 

Definition
hypothetical protein
Organism
lki  Leuconostoc kimchii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
580320..580691
Genome map
AA seq 123 aa AA seqDB search
MNIIELLGLKTTLLSSEKTIVEVAVSQKLMQPFGIVHGGINALLAETAASLGANEVLTDN
LVPVGVDIQTHHLKPVTQGVLVATATPISIGHTLQVWSVMIHEQNTNTLTSTSTVTLKNH
LLK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatagaacttttggggttaaaaaccaccttattgtcatcagaaaaaacaatt
gttgaagtggcagtcagtcaaaaactgatgcaaccatttggtattgtacatggcggtatt
aatgctttgttagctgaaacagccgcttcattaggcgcaaacgaggtcctgacggacaac
ttagttcctgtaggcgttgatattcaaacacaccatttaaaacctgttactcagggcgtg
ttggtcgcaactgcaacaccaattagcattggacataccttacaagtctggtcggttatg
atccacgagcaaaacacaaacacgttaacaagcacgagtactgtgacactcaaaaatcat
cttttaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system