KEGG   Leuconostoc kimchii: LKI_03340Help
Entry
LKI_03340         CDS       T01233                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lki  Leuconostoc kimchii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LKI_03340
Enzymes [BR:lki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LKI_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
644924..645862
Genome map
AA seq 312 aa AA seqDB search
MKNKVVVIGSLNMDTIQMIDRLPQRGETLAVRNQASTFGGKGANQAVAAARQGADVTFIG
AVGNDDRGRAFKQLLVDEGIKTDYIFTKNQPTGSATIMLEDDGHNTIMVFGGANMSLSAD
DISQARAAIVAADVVVAQLEVPMAAVAKGFEIAREAGVLTILNPAPVTSHLTDEIMLTTD
LLIPNETEAAALADVQSTTDSQALEQLTLKLRRLGMAHTIVTLGGDGVYYHVNDQSGQVP
IFKVDAVDTTAAGDTFIGTVAANITKEMTDLPTIIKRSCFASSLTVSRRGALVSIPTKAE
VDAGLQQYSMVK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaagttgtcgtgattggtagtcttaatatggacacaatccaaatgattgat
cggctaccacaacgtggtgagacgcttgctgttagaaatcaggcaagtacttttggtggt
aaaggcgctaatcaggcggtggccgctgcgcgtcaaggtgcagacgtcacgtttattggt
gctgttggtaatgacgaccgtggccgtgcatttaaacaattgttggtcgacgagggcatc
aaaacagattacattttcactaaaaatcaaccaaccggttctgcaaccattatgttggaa
gatgatgggcacaatacgattatggtatttggtggtgccaacatgtcattgagtgcagat
gatatttcacaagcgcgtgcagcaattgttgcggcagacgttgttgtggcacaactagaa
gtacctatggcagctgtagcaaagggatttgaaattgcacgtgaggctggtgtgttaacc
attttgaatccagcgccggtaacatcacatttgactgatgaaatcatgttaacgactgat
ttattaatcccaaacgaaactgaagcggcagcgttagctgatgttcaatcaacaacagat
agccaagctctagagcagttaacactaaaattacgacgcttgggcatggcacatacaatt
gttacccttggcggggatggtgtgtactatcatgttaatgaccagagcggtcaggtacca
atttttaaagtagatgcggtagatacgacagctgcaggtgatacatttattggtacagtg
gcagcgaatatcacgaaagaaatgactgatttgccaacaattattaaacgtagttgcttt
gcgagttcattaactgttagccgtcgcggtgcacttgtctctattccaacgaaggcagaa
gtagatgcgggtctgcaacaatacagcatggtgaagtga

DBGET integrated database retrieval system