KEGG   Leuconostoc kimchii: LKI_03735Help
Entry
LKI_03735         CDS       T01233                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lki  Leuconostoc kimchii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LKI_03735
Enzymes [BR:lki01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LKI_03735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714877..716334
Genome map
AA seq 485 aa AA seqDB search
MYKTTYENSFPKGFLWGGATAANQIEGAWNLDGKGLSTAEVVQKADDRRKMSMGDVTEET
LAIALADKTDDLYPKRRGVDFYHHYKEDIALFAEMGFKVYRFSIAWSRIFPQGEDAQPNE
AGLVFYDNVLAELAKYDIVPLVTLSHYEMPVVLTQKYNGWAGRETIAAFNRFTETVFNRY
HDQVDYWLTFNEINTGTWGFHETGAIDKGLSEREQLQIRYQALHHQFVASAIATKQLHQI
DPNAKIGSMLARMQTYPATPKPEDVRAAQLEDEKNLFFTDVQARGEYPEYMNRFFSENGI
VIHMAEDDQAILLENPVDFISFSYYMTNVTQHNQVDDGVGNMAVGGRNPYLKESDWGWQI
DPVGLRITLNAMWDRYRKPLFIVENGLGALDKLEDDGHVHDQYRIDYLRAHIEQMKEAIK
DGVNLLGYTMWGPIDLISFSTSEMSKRYGFIYVDQDDDGKGTLKRIKKDSFTWYKEVIAS
NGETL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaacaacttatgaaaactcatttcccaaaggattcttatggggtggtgcgact
gcggctaatcaaattgaaggtgcttggaaccttgatggcaaagggttaagtacggctgag
gttgtccaaaaggctgatgatcgtcgtaaaatgtctatgggtgacgtcactgaagaaacg
cttgcaatagcattggctgataaaacagatgatttatatcctaagcgacgtggtgttgat
ttttatcatcactataaagaagatattgcgctttttgcggaaatgggatttaaagtgtat
cgcttctcgattgcatggtctcgaattttcccacaaggagaagatgcacaaccaaacgaa
gcaggtttggtattttacgacaatgtattagccgaattagccaaatatgatattgtgcca
ctagtgacgttgtcacactatgagatgccagttgttttgacacagaaatataatggttgg
gctgggcgcgaaacaattgctgcatttaatcgttttactgagacagtattcaaccgttat
catgatcaagttgattattggttgacatttaatgaaatcaatacaggtacctggggattt
cacgaaacgggggccattgataaaggcctttcggaaagagaacagttacagattcgttat
caagcgttacatcaccaatttgtcgccagcgctattgcaacaaagcaattgcatcagatt
gatccaaatgccaaaattggatcaatgttggcacggatgcagacgtatcctgcgacacca
aagccagaggatgtcagagcggcacaattagaagatgaaaaaaatctgttttttacagat
gtacaagcacgtggcgagtatccagaatatatgaaccgttttttcagtgaaaacggcatt
gtgattcacatggcagaagatgaccaagctattttgcttgaaaatccagtagactttatt
agttttagctactatatgactaatgtgacacagcataatcaggttgatgatggtgtgggt
aacatggccgttggcgggcgtaatccttatttgaaggaatcagattggggatggcaaatt
gatcccgttggattacggataactttaaatgcgatgtgggaccgttaccgcaaaccacta
tttattgtcgaaaatggcctaggtgctttagataaacttgaagatgatggtcatgtgcat
gatcagtatcgtattgattatttacgtgcacatattgagcaaatgaaggaagcaatcaag
gatggtgttaatctcttaggttatacgatgtgggggccaattgatttgattagtttttcg
acatcagaaatgtcaaaacgatatggtttcatttatgttgatcaagatgatgatggcaag
ggcactttgaaaagaattaaaaaagattccttcacgtggtacaaagaggttattgcctcc
aatggtgaaacactctaa

DBGET integrated database retrieval system