KEGG   Leuconostoc kimchii: LKI_04135Help
Entry
LKI_04135         CDS       T01233                                 

Definition
alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lki  Leuconostoc kimchii
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LKI_04135
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LKI_04135
   00620 Pyruvate metabolism
    LKI_04135
   00650 Butanoate metabolism
    LKI_04135
  Lipid metabolism
   00071 Fatty acid degradation
    LKI_04135
  Amino acid metabolism
   00350 Tyrosine metabolism
    LKI_04135
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LKI_04135
   00626 Naphthalene degradation
    LKI_04135
Enzymes [BR:lki01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LKI_04135
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LKI_04135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
787586..790288
Genome map
AA seq 900 aa AA seqDB search
MVETMIKKPAKKVLTPEEKAELQTQAEKMTAELVEKSQKALTAFSTFTQEQVDKIVAAMA
LAGSENSLVLAHAAHDETGRGVVEDKDTKNRFASESVYNAIKFDKTVGVISEDKIQGKVE
LAAPLGVLAGIVPTTNPTSTTIFKAMLAAKTRNTIIFAFHPQAQKSSALAAKIVYDAAVK
AGAPENFIQWIEKPSLYGTSALIQNKGIASILATGGPAMVNAALKSGNPSMGVGAGNGAI
YLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYDEVLQKMQAQGAYLVPKKDY
KKIADYVFKPNAEGFGVAGPVAGMSGRWIAEQAGVKIPEGKDVLLFELDQKNIGEALSSE
KLSPLLSIYKVEKREEAIETVQALLSYQGAGHNAAIQIGSQDDPFIKEYADAIGASRILV
NQPDSIGGIGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNIKTVARRRNRPQWVRL
PKEVYYEANAITYLQELPAVKRAFIVADPGMVQFGFVGKVLSQLELRQEQVETNIYGSVK
PDPTLSEAVGIARQMAAFKPDTVILLGGGSALDAGKIGRFLYEYSTRHEGILEDEEGIKN
LFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSGTGSEVTPFAVITDDQTHVKYPLADY
ELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHALESYVSVMSSEFTRPWALQAIKLIFEN
LTTSYQYDPKNPTKEGQNARSKMHYASTLAGMSFANAFLGINHSLAHKTGGEFGLPHGLA
IAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQKDYADIARYLGLKGNTDVELVDALIAAV
KNLAKSVEVDQTLTGNGVKKVDLENNIEKLTDLVYNDQCTPGNPRQPSLAEIQQLLRDQL
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaacaatgataaagaagcccgcaaagaaggttttgacacccgaagaaaaggca
gaattacaaacccaagcagaaaaaatgacggcagaattagttgaaaaatcacaaaaagct
ttaacagcattttcaacatttacacaagagcaagttgataaaatcgtcgcagcaatggca
ttagctggctcagaaaattcactcgtacttgctcatgcagctcatgatgagactggccgt
ggggtcgttgaagataaggatacaaaaaatcgctttgcctctgaatctgtatacaacgct
atcaaatttgataaaacagttggtgtaattagtgaagacaaaatacaagggaaagtcgaa
ttagcagcgccactcggtgtactagctggtattgtaccaactacgaacccaacatcaacg
acgatttttaaagccatgttggcagccaagacacgtaacacaattatctttgcattccat
ccacaagcacaaaagtcatcagcactcgctgcaaaaattgtttatgatgccgctgttaag
gctggtgcacctgaaaactttatccaatggattgaaaagccatcactttatggcacaagt
gcattaattcaaaataagggcattgcctcaatcttggcaactggtggaccagcgatggtt
aatgcagccttgaagtcaggtaatccatcaatgggtgttggtgctggaaacggtgcgatt
tatcttgatgcgacagttgacactgaccgtgccgtgtctgatttgcttttgtcaaaacgt
tttgataatggtatgatttgtgccactgaaaactcagccgttattcaagcaccaatttat
gatgaagtactacaaaaaatgcaagcgcaaggcgcttacctagtccctaaaaaagattat
aagaaaattgctgattatgtgtttaagccaaatgcagaaggatttggtgttgctggtcca
gttgctggtatgtcaggtcgttggatagctgagcaagctggtgttaaaattcctgaaggc
aaagatgtcttgctattcgaattggatcaaaagaatattggcgaagcactgtcatcagaa
aagttatcgcctttactatcaatttataaagttgagaagcgtgaagaagcgattgaaaca
gtacaggcattactgagttatcagggtgcaggacataatgctgctattcaaattggttca
caagatgatccatttattaaagaatatgctgatgctattggtgcatcacgtatcttagtt
aaccaacctgattcaattggtggtattggtgacatttatacagatgctatgcgcccttct
ttgacgcttggtaccggatcatgggggaagaattcattgtctcacaacttatcaacatac
gatttgctcaatattaaaacggttgctcgccgccgtaatcgaccacaatgggttcgctta
cctaaggaagtttattatgaagcaaacgctattacttacttacaagaattaccagcagtt
aagcgtgcctttattgttgctgatccaggtatggtgcaattcggctttgttggtaaggta
ttgagccagttagaattacgccaagaacaggttgagacaaatatctatggttcagttaag
cctgatccaactttgtctgaagcagttggcattgcacgtcaaatggctgctttcaagcct
gatacagtgatcctattgggtggtggttcggcattagatgcgggaaagattggtcgcttc
ttgtatgaatactcaacacgtcatgagggtattttggaagacgaagaagggatcaaaaac
ttattcatggaattgcaacaaaagttcatggatattcgtaagcgtatcgttaagttctac
cacgcccgcttgacacaaatggtcgctattccaacaacgtctggtactggttcagaagtc
acaccatttgcggtaattaccgatgaccaaacacatgttaagtatccattagctgactat
gagttgacaccagaagtagccattgtggatccagaatttgtcatgacagtgccaaagcgt
acagtagccttttctggattagatgcactatctcatgcgttggaatcatatgtatcagtt
atgtcttctgaattcacacgaccatgggctttgcaagcgattaagttgatttttgaaaac
ctaacaacgtcataccaatatgaccctaaaaatccaaccaaggaaggtcaaaatgcccgt
tcaaagatgcactatgcttcaacactagcaggtatgtcatttgctaacgcattcttaggc
attaaccattcattggcccacaaaactggtggtgagttcggtttgcctcacggattggct
attgccattgcgatgccacatgtgattaagtttaatgccgtgacaggtaacgttaagcgc
acgccttacccacgctatgagacatatacagcacaaaaagattatgctgatattgcgcgc
taccttggcttgaagggcaatacagatgttgaattggtcgatgctttgattgctgccgtt
aagaatttggctaagtcagttgaagttgaccaaacattaacaggtaatggtgttaagaaa
gtagatctagaaaacaatattgaaaaattgacggatcttgtttataacgatcagtgcaca
cccggaaacccacgccaacctagtttggcagaaattcaacaattgttgagagatcaactt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system