KEGG   Leuconostoc kimchii: LKI_06925Help
Entry
LKI_06925         CDS       T01233                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lki  Leuconostoc kimchii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lki00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LKI_06925
DNA repair and recombination proteins [BR:lki03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LKI_06925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355717..1356322
Genome map
AA seq 201 aa AA seqDB search
MEYPEPIAKLIDSYTKLPGIGSKTATRLAFYTLGMNEDDVVDFSKSLLSAKNDLTFCSIC
GNITENSMNPCVICQDTSRDQSTVFVVENSRDVMAMENTRDYHGLYHVLNGVISPLAGTG
PEDINLPSLIRRLSQHQEIDEVIVGTNVNAEGEATAMYLARLLKPAGIKVTRLAHGLAVG
SDIDYADQLTLIKAVQGRTEL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaatatccagaaccaattgcaaaattaatagatagctatacaaagttgccggggatt
ggatcaaaaacagcaacacgattagcattttacacactgggcatgaatgaggatgatgtg
gtagatttttcgaaatcactactttctgctaaaaatgacctgacattttgttcaatatgt
ggtaatattacagaaaattctatgaacccatgtgttatttgccaggatacatcacgcgac
caatctacggtatttgttgttgagaattctcgggatgtcatggcaatggaaaatacccgg
gattatcatggattgtatcacgttttaaatggcgtcatatcaccgcttgcaggtactggt
cccgaagatattaatttacctagcttaatcaggcggttatcccagcatcaggaaattgat
gaagttatcgtaggcacaaacgttaatgccgagggagaagctactgccatgtacttggca
agattgttgaagcccgccggtattaaagtgacacgattagcgcatggcttggcagttggc
tctgatattgattatgccgatcaattgacacttattaaagccgtacaaggacgaacagaa
ctatga

DBGET integrated database retrieval system