KEGG   Leuconostoc kimchii: LKI_08130Help
Entry
LKI_08130         CDS       T01233                                 

Definition
phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lki  Leuconostoc kimchii
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lki00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1603100..1604536
Genome map
AA seq 478 aa AA seqDB search
MTQSLPKDFLWGGAVAAHQLEGGWQEGGKGISVADVMTAGGPNKARGITDGVVPGEYYPN
HEAIDFYHHYKEDISLFKEMGFKCFRTSIAWTRIYPTGEETEPNESGLKFYDDLFDELIK
HDIEPIVTLSHFELPYHLVTKYGGFRNRKLIDLFVKFATTCLQRYQGKVTYWMTFNEINN
QANYDNDFSVFTNSGLHFEPGENREEGMYQAAHNELVASARVVKIGHNINPDLKMGCMIA
MGPVYPATMAPDDVLAAQKAMEKNYFFADVHVNGFYPSFLTKYWARQGFEIDVTAQDEQD
LHNGTVDYIGFSYYMSHAIQKNEGRSFDELTMQNSLVRNTYLEASDWGWQIDPKGLRYAL
NWFTDKYHLPLFIVENGFGAYDKVEPDGSIHDDYRIDYLREHIRQMKLAVTEDGVDLIGY
TPWGCIDLVSAGTGEMDKRYGFIYVDKNNKNEGSLARSKKDSFEWFKTVIATNGEQLN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaagtttaccaaaagatttcctttgggggggagcagtagctgcacaccaactt
gaaggtggctggcaagaaggtggtaagggtatcagtgttgcagacgtaatgactgctggt
gggccgaataaagcacgtggtattacagatggcgtagtaccgggcgagtattatcctaat
catgaagcgattgatttttatcatcattacaaagaagacattagcttatttaaggaaatg
ggttttaaatgttttcgaacatcaattgcgtggactcgaatatatccaacaggagaggag
acggaaccaaacgagtcaggtttgaagttttatgatgatttgtttgatgaattgatcaaa
catgatattgagcccattgtgacgctttctcactttgaactaccttatcatctagtaacg
aaatatggtggattccgcaatcgtaagttgattgatttgtttgtgaaatttgcgacaaca
tgcttacaacgttatcaaggtaaagtaacgtattggatgacgtttaacgaaattaataat
caagcaaattatgacaatgatttctctgtgttcactaattctggattacattttgagcca
ggtgaaaatcgtgaagaagggatgtatcaagcagctcataatgaactagtggccagcgca
cgcgtagttaaaattgggcacaatattaatccagatttgaaaatgggatgtatgatcgct
atggggccagtttatccagcaacaatggccccagacgatgtactagcagctcaaaaagca
atggaaaaaaattatttctttgcggatgtccacgttaatggcttttacccatcattttta
acaaagtattgggcacgtcaaggatttgaaattgatgtgacagcacaagacgagcaagat
ttgcataatggtacagtggattatattggttttagttattatatgtcacatgcaattcag
aaaaatgaaggacgctcatttgatgagttaacgatgcaaaatagtctcgttcggaatact
tatttagaagcaagtgattggggatggcagattgaccctaaggggttgcgttatgcgtta
aattggtttaccgataaatatcatctccctttgtttattgttgagaacggctttggtgcc
tatgacaaggttgaacctgacggatcgatacatgatgattatcggattgactatttgaga
gagcatatacgtcaaatgaaattagcagtcacagaagatggtgttgatttgataggttat
acaccatggggctgcattgacttggtgtcggcgggcactggtgaaatggataagcgttac
ggtttcatatatgtggacaaaaataacaaaaatgagggttctttagctagatctaaaaaa
gattcatttgagtggttcaagacagttattgcgacaaacggtgagcagttaaattag

DBGET integrated database retrieval system