KEGG   Leuconostoc kimchii: LKI_08170Help
Entry
LKI_08170         CDS       T01233                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lki  Leuconostoc kimchii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LKI_08170
  Amino acid metabolism
   00340 Histidine metabolism
    LKI_08170
Enzymes [BR:lki01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LKI_08170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1611972..1613249
Genome map
AA seq 425 aa AA seqDB search
MQIIKNESINQIKARIRQQTLKTVDPQVENRVADIIATVREKGDVALKSYAKAFDDVSLD
VLKVSSSQINQAMKSVDPEVIAALEKAAANIRSFHQLELQTSFEDSPRPGVLRGTKVTAL
SAVGIYVPGGTAAYPSSVLMNALPAKIAGVKNIIMVTPPQKDGTNPVVLAAAKIAGIDSI
YQVGGAQAIAALAYGTESIPKVDKITGPGNAYVATAKRAVYGQVAIDMIAGPSEIGILAD
DSARPQDVAADLLSQAEHDVNARAILITNSEKLAQAVSDEVDKQLLTLPRVDIARAAVDS
NGFIYLVDTVDDMIDLMNVVAPEHLEIQLENAYDYLAKIQNAGSVFLGKYASEPLGDYLA
GPNHILPTGGTARFSSALGVWDFQKRIQYLDYSQAALSDDASDVAALAREEGLEAHARAI
EVRQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagattattaaaaatgagtcgattaatcaaattaaggcccgtattcgacagcaaacg
ctaaaaacagttgatccacaggttgaaaatcgtgttgctgatattattgcaactgtgcgc
gaaaaaggtgatgttgcgctaaaatcatatgccaaagcctttgatgatgtatcacttgac
gtattaaaagtgagctcatcgcaaattaaccaagcaatgaaatcggtagaccctgaagta
attgcagccttagaaaaagcagcagccaatatccgatcgtttcaccaattagagttacaa
acatcatttgaagattctccacgccctggtgtgctacgcggtaccaaagtgacagcgtta
tcagcagttggcatttatgtgcctggtggtacggcggcttacccatcatcagtcttaatg
aacgcactgccagctaaaatagccggtgttaaaaatatcattatggtaacaccaccacaa
aaagatggtaccaatccggtggtgttggcagcagccaaaatagctggcattgatagcatt
tatcaagtgggtggtgcacaagccattgcggcacttgcatacggtacagagtcaatacca
aaagtagataaaatcacggggcctggcaacgcttatgtcgccactgccaagcgcgcagtt
tacggacaagttgcgattgatatgattgcaggaccgtcagaaataggtattttagccgac
gattcggcacgtccacaagatgttgcggccgatttattgtcacaagccgagcatgatgtt
aatgcgcgagccattttgattacaaattcagaaaaattagcgcaagctgtttcggatgaa
gtggacaaacaactgctcacattgccgcgtgttgatatcgcgcgtgctgcagtcgatagt
aacggttttatttatctcgttgacacagttgatgacatgattgatttaatgaatgttgtt
gcaccagaacatttggaaattcagctggaaaatgcctatgattacttagctaaaatacaa
aatgccggctctgtatttctgggaaaatatgcctctgaacccttaggtgactaccttgcc
ggaccaaatcatattttaccaactggtggtactgcgaggtttagttcagcattgggtgtt
tgggattttcaaaagcgcattcaatatttggactattcacaagccgcgttaagcgatgat
gccagcgatgttgctgcactagcccgtgaagaggggttagaagctcacgcacgtgccatt
gaagtacgtcaatcttaa

DBGET integrated database retrieval system