KEGG   Leuconostoc kimchii: LKI_08370Help
Entry
LKI_08370         CDS       T01233                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lki  Leuconostoc kimchii
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LKI_08370
Enzymes [BR:lki01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LKI_08370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650588..1652039
Genome map
AA seq 483 aa AA seqDB search
MKKLTNEAMLITYADSLGKNLKELNQVLTNELDGVVGGVHVLPFFPSTGDRGFAPEEYET
VDPKFGDWSDVEKLADKYYLMFDFMLNHISPQSKYFQDFLEKKEESEYYDMFLKYSEFWP
ENRPTDADIDMIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQMDLDVTKEVTKKFIKDSL
VNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWAILDEVREILAAEGSEVLPEIHEHY
KIVRKITDHDMYSYDFALPLLTLYSLYSGKTNRIADWLRQSPMKQFTTLDTHDGIGVVDA
KDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQINTTYYSALGNNDAAYLLARA
TQIFAPGIPQIYYVGLLAGENDIELLESSKEGRNINRHYYDLAEIAETTKRPVVSNLFDL
LRFRNTSAAFDLEGKIEVVNDGENELTVTRSSADGKTVAVLDANFATKNFTVTENGKEIF
TTK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactgacaaacgaagcaatgcttatcacatatgctgactcacttggaaagaac
ttaaaggaacttaatcaagtattgactaacgaacttgatggtgtcgtgggtggcgttcac
gtcttaccatttttcccatcaactggcgatcgtggctttgcacctgaagaatacgaaaca
gtagatccaaagtttggtgactggtctgatgttgaaaaattagcagataagtattactta
atgtttgattttatgttgaaccatatttcaccacaatcaaagtacttccaagactttttg
gaaaagaaggaagagtcagaatattatgatatgttcttgaagtattcagaattttggcca
gaaaaccgtccaacagatgcagatattgatatgatctacaagcgtaaggataaggcaccg
tttgctcctgtgacatttgctgacggtacaactgaccaagtttggaacacatttggtgat
caacaaatggatttggatgttactaaagaagtaacaaagaagtttattaaagattcattg
gttaatttggctcatcatggtgcttctgttattcgtttggatgccttcgcatatgctatt
aaaaagttagacacaaatgatttcttcgttgaacctgaaatttgggctattttagatgaa
gtacgtgaaattttggccgcagaaggttcagaagtattacctgaaattcatgaacactac
aaaattgttcgtaaaattactgatcatgacatgtattcatacgactttgcattaccatta
ttgacattgtattcactatactcaggtaagacaaaccgtattgctgattggctacgtcaa
agtccaatgaagcaattcacaacattggatacgcatgacggtattggcgttgttgatgca
aaagatttgttgactcaagaagaaacagatttcacaactgaagaaatgtataaggttggg
gcaaatgttaagaagatattctcttcagctgcttacaacaacttggatatttatcaaatt
aacacaacttactattcagcattgggtaacaacgacgcagcttacttattagcacgtgcc
acacaaatctttgcgcctggtattccacaaatttattatgttggtttgcttgctggtgaa
aatgatatcgaacttttggaaagctcaaaagaaggtcgtaacattaaccgccattattat
gatttggctgaaattgctgaaacaacaaagcgaccagtagtttcaaacttgtttgatttg
ctacgcttccgcaatacaagcgctgcctttgatttagaaggtaaaattgaagttgttaat
gatggtgaaaatgaattaacagtaacacgttcatcagcagatggtaagacagtcgctgta
ttggatgctaactttgcaactaaaaactttactgtaactgaaaatggtaaagaaatattt
acgacaaagtaa

DBGET integrated database retrieval system