KEGG   Leuconostoc kimchii: LKI_08470Help
Entry
LKI_08470         CDS       T01233                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lki  Leuconostoc kimchii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lki03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1671014..1671604
Genome map
AA seq 196 aa AA seqDB search
MYEYINGLITNIYPAYLVICDRSGVGYKLFAANPYRFEQNVESHVYVEQIVRENDIAMYG
FIDENEKILFNKLLNVSGIGPKSALAILASDDATGLVNAVANDDASYLTQFPGVGKKTAQ
QIVLDLKGKLDDLAISAGVQGPTREQNTNQALSDALEALESLGYSAKEVAKLEKTLASQQ
DTTDGYIRSALKLLVN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgaatatattaatggcttaattacgaatatttatccagcttacttagttatctgc
gatcgcagtggtgtggggtataaactatttgcagctaatccttatcgttttgaacaaaat
gttgaatctcatgtatatgttgagcaaattgtacgtgaaaatgatattgccatgtacggc
tttattgatgaaaatgaaaaaatattatttaataaattacttaatgtctcggggattgga
cccaaaagcgcgctagcaattcttgctagtgatgatgcaacaggtttagtcaatgcggta
gccaatgatgatgcaagttatttgacgcaattcccgggtgttggtaaaaaaacagcgcaa
caaattgttttagacctaaagggtaagttggatgatttggcaatatcagctggtgtccag
ggaccaacaagggaacaaaatactaatcaagcattgtcagatgcgttggaagcgctagag
tcgttgggctatagtgcaaaagaagtggctaagctggagaaaacgttagccagtcaacaa
gatacgacagacggttatattcgttcagcactaaagttattggtaaactaa

DBGET integrated database retrieval system