KEGG   Leuconostoc kimchii: LKI_08645Help
Entry
LKI_08645         CDS       T01233                                 

Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lki  Leuconostoc kimchii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    LKI_08645
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LKI_08645
Enzymes [BR:lki01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     LKI_08645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1711362..1711958
Genome map
AA seq 198 aa AA seqDB search
MTEDFFEKKLAGKAIPAIPGMIEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFQDNKL
QNNVSLSRKGVLRGLHAEPWDKYISVADNGRVLGSWVDLREGDSFGHVYQTVIDASKGIY
VPRGVANGFQVLSETVSYSYLVNDYWALALKPKYAFVNYADPALGITWDDVENAEVSEAD
KNHPLLEDVVPLTKEQLQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagattttttcgaaaaaaagttagcggggaaagcgattcctgcaattcctggc
atgattgaatttgatattccggttcacggtgataatcgtggctggtttaaagaaaacttt
caaaaagaaaagatgttacctttaggttttcctgaatcatttttccaagacaataaatta
caaaataatgtgtccttatcacgcaagggtgttttgcgtggcttacatgcggaaccatgg
gataagtatatttctgtggctgataatggtcgtgtgttaggatcttgggttgatttacgc
gaaggtgattcatttgggcatgtctaccagaccgtgattgatgccagtaagggtatttac
gtaccacgtggtgtcgccaacggctttcaggtattgagtgagacagtgtcatattcttat
ctggttaatgattattgggcgttagcgttaaagccaaaatatgcctttgtcaactatgca
gatcctgccttgggcatcacgtgggatgatgttgaaaatgctgaagtcagtgaagcagat
aaaaatcatccgctactagaagacgttgtgccactgacaaaagagcaattacaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system