KEGG   Leuconostoc kimchii: LKI_09475Help
Entry
LKI_09475         CDS       T01233                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lki  Leuconostoc kimchii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LKI_09475
   00670 One carbon pool by folate
    LKI_09475
Enzymes [BR:lki01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LKI_09475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1877510..1878025
Genome map
AA seq 171 aa AA seqDB search
MTKIKMVWAEDREHAIGKNGNLPWRLPDDLKLFREETTNTLMIMGRTTWSSIGRPLPNRQ
TLVLTRQADWQIPFEDVLVTHSVAETLDTIRAESKDVAIAGGAAIYRAFMPYATDLIVTR
IDGIINGDTFVDAIDLTTFELVSRQPHDKDDRHDYAFVVERYKRRNRGENV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaattaaaatggtctgggcggaggatagggaacatgctattggaaaaaatggt
aacttaccatggcgcctaccagatgatttgaagctttttcgtgaagaaaccactaatacc
ttgatgatcatgggtcgtacaacatggtcgagcattggtcgcccgttaccaaatcgtcaa
acgcttgtgttgacaagacaagcagattggcaaataccttttgaagatgttttggtgaca
cattcagttgcggaaacattggatactattcgagctgaatccaaagatgttgccattgct
ggcggcgcagcgatttatcgcgcgtttatgccgtatgccacagatctgattgtaacgcgt
attgatggtataattaacggtgatacatttgtagatgcgattgatttgacaacttttgag
ttagtcagtcgtcagccgcatgacaaagatgacaggcacgactatgcgtttgttgtggag
cgttataagcgtagaaatcgaggagagaatgtctaa

DBGET integrated database retrieval system