KEGG   Leuconostoc kimchii: LKI_10095Help
Entry
LKI_10095         CDS       T01233                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lki  Leuconostoc kimchii
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lki00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LKI_10095
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LKI_10095
Enzymes [BR:lki01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LKI_10095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1987445..1987933
Genome map
AA seq 162 aa AA seqDB search
MSDDVYQFTVTTEDGKTYSLDKFRGRPMIIVNTATKCGFAPQFSDLEKIYQTYQEQGLVI
LGFPSNQFKQELDSSHEAAQACQLTYGVTFPMHQLIAVNGKNTDPLFKYLKKNADSPLGT
TIKWNFTKFLVNREGQVIKRFAPKTNPADMIPDIKRVVDQTV
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgatgtataccaatttactgttacgacagaggacggcaaaacttattctttg
gataaatttcgtggccgtccaatgattattgtaaatactgcgacaaaatgtggttttgca
ccacaattttcagatcttgaaaagatctatcaaacctatcaagaacagggattagttatc
ttaggatttccttctaatcagttcaagcaggagttagattctagtcatgaagctgcccaa
gcttgccaattaacttacggtgtgacatttccaatgcaccagttgattgcggttaatggt
aaaaataccgatccactatttaaatacctcaaaaaaaatgcagatagtccattaggaacc
acgattaagtggaattttacgaaatttttagttaatcgtgaagggcaagttatcaaacgt
tttgctcctaaaacgaatccagctgatatgataccagatattaaacgtgttgtagatcaa
acagtttaa

DBGET integrated database retrieval system