KEGG   Leuconostoc kimchii: LKI_10376Help
Entry
LKI_10376         CDS       T01233                                 

Definition
type III restriction-modification system, restriction endonucleasesubunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
lki  Leuconostoc kimchii
Brite
Enzymes [BR:lki01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     LKI_10376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
LkipL4701:14177..17293
Genome map
AA seq 1038 aa AA seqDB search
MKLQYKNQPFQLEAVESVIATFEGQPRKNNMSYMMDMGHEKNVSLDIVNGFKNADITLSE
SDLLKNIQVTQKNNGLVTDTQLVKMAIGGRDKSTKIDNSRDILTLSVEMETGTGKTYTYI
KTMLELNKQYGWSKFIIVVPSVAIREGIAKTFESTAEHFKQAYGVGVRYFIYHSSHLDQI
EAFASDAGINVMIVNTQAFNARGADARRIDMVLDQFRGRRPIDVISATHPIMIIDEPQSV
LGNGSKADLNATRVGLAKFNPLFFINYSATHRDNYNMIYRLDAVDAYQKNLVKKIAVKGI
EISGSNASSGYLYIEAIKEQPTLKVRIQFDKLSATGSVVKTSKLLDKGDNIYPISGEIES
YKSGFIISEINAVEQFVEFTNGMRLSVGEVVGNTNEEDLRRIQIRETIQSHFAKEEILFK
RGIKTLSLFFIDEVSKYKNYDAIDDKGIYATIFEEEYLNIARDRLADSLLDANYRSYLER
ELKSPEKVHAGYFSIDKKGKAVDSKIKRGSESSDDISAYDLIMKNKERLLSFEEPVRFIF
SHSALKEGWDNPNVFQIATLRQSSSDIKKRQEIGRGLRLAVNQNGDRQDAQYLGENEVKQ
VNVLTVIANESYETFARGLQSEISDAIKNRPKFIEPKLFEGRELVVEDSTGQVTDRILVD
NTQAAEIWSSLKSGMLIDKNKQSSDTYKNLSAPEQLAAIQDALDDDLKIFALPIQNLINS
VYSPKDLPIDNENKRTTLKLNREKYASTEFKSLWSKINRKSYYTVDFDDQEIIEKSIQLI
NKNLTVKTLKARITEGNMSANDTGTSFTVNDKRTTDIDRPVNHVKYDLIGEVSQNVGLLR
KTVGYILTGIHSGQFAKYQSNPENFIVQISNIINAVKAQNIISHIVYNKLDEVWDEDAIF
ANNDIQGIMGQNVFDAKKHLYDKVRVDSEVEKRFASELDVEQNVEMYVKLPGGFYINTPV
GKYNPDWAIVLNEPDQKHVYFIAETKGVSENIELSLKGVENAKIESARQHFKIISNSEVT
YDVVDSYEKMMDKLSSNI
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcagtataaaaatcaaccctttcagctagaggccgtagagtctgtcatagct
acttttgagggacaacctagaaaaaataacatgtcttatatgatggatatgggacatgaa
aaaaacgtatctttagacattgtcaatggatttaaaaacgcagatatcacattatctgag
agtgatcttttaaaaaacattcaagtaactcaaaaaaacaatggactagtaactgatact
cagctagttaaaatggccattggtggtagagataaaagtacaaaaattgataattctcgc
gatattctaactttatcagtagaaatggagactggtacaggtaagacatatacgtatatc
aagacaatgcttgaattaaacaaacaatatggctggtcaaaatttatcattgtcgttcca
agcgtcgccattcgtgaaggtatagccaaaacatttgagtctaccgccgaacactttaaa
caagcatacggtgttggtgttcgttactttatttatcattctagtcaccttgatcaaatt
gaagcatttgcgagcgatgcaggtatcaatgtaatgatcgtcaatacacaggcctttaac
gcacgtggagctgatgcaaggcgaatcgacatggtattagatcaattccgtggtagacgc
cctattgatgtcatttcagcaacccatccaataatgatcattgatgaaccgcaatcggtt
ttaggaaatgggtcaaaagctgacctgaatgcaacacgcgttgggttagcaaaatttaat
cctctatttttcattaattactcagcgacacatcgtgataactataatatgatttatcga
ttagatgctgtagatgcctatcaaaagaatctagtaaaaaaaatcgcggttaaagggatt
gaaatatcgggttccaatgcatctagtggctatctatatattgaagccattaaagagcaa
ccaacattaaaggtacggattcaatttgataaattatccgctacagggagtgtggttaaa
acttccaagttattagataaaggcgacaatatttaccctatttcgggggaaatagaatct
tataaaagtggatttatcatatcagaaattaatgctgtggagcagtttgttgaatttact
aacggtatgcggttatctgttggtgaagtcgttggaaatactaacgaggaagatttgaga
cggatacaaatccgtgagaccatccaatcgcattttgctaaagaggagattctatttaag
cgcggtattaaaacgttgtccttatttttcattgatgaagtatctaaatataaaaattat
gatgctatcgatgacaaaggaatttacgctacgatttttgaggaagaatatctcaatatt
gcacgagatcgattagcggattctttattagacgcaaattatcgctcttatcttgaacgc
gaattgaaatctcctgaaaaggttcatgctggatacttctcaatcgataaaaaagggaag
gctgttgatagtaaaatcaaacgtggtagtgagtctagtgatgatatttcagcctatgac
ttgattatgaaaaataaagagcggcttttatcatttgaagaacctgttcgttttattttc
tctcactcagcgctaaaagaaggatgggataatcccaatgtctttcaaattgcaacgttg
cgtcaatcttcatctgatattaagaaaagacaagaaatcggtcgtggattacgtttggca
gttaatcaaaatggcgaccgccaagatgcgcaatatttaggtgaaaatgaggtgaaacaa
gtaaatgtgttgaccgttatcgccaatgagagttacgaaacatttgctcgaggtcttcaa
tctgaaatatctgacgccatcaaaaatagacctaaattcatcgaacccaagctatttgaa
gggcgagaactagttgtagaagatagcactggacaagtaactgacaggatactggttgat
aatactcaggcagctgaaatatggtctagtttaaaatcaggcatgctcatcgacaaaaat
aagcaatcgtctgatacttataaaaacctatccgctccagaacaattagcagcaattcag
gatgccttagatgatgatcttaaaatattcgcactacctattcaaaatttaatcaatagt
gtatatagcccaaaagatttgccgattgacaatgagaataaacgcactactttgaaatta
aatcgtgaaaaatatgctagtacagaatttaaaagcttatggtcaaaaataaaccgaaag
tcttactataccgtcgattttgacgatcaagaaattattgaaaagtcaattcaacttatc
aataaaaatttaacggtgaaaacgctaaaagctcgtattactgaaggtaatatgtccgcg
aatgatacgggaacaagttttacagttaatgataagcgaacaactgatatcgataggcct
gtaaaccatgtgaaatatgatttaatcggagaagtttctcaaaatgtagggttactacgg
aaaacagttggttatattctaactggtatccactcaggacaattcgcaaaatatcaatct
aatcctgaaaacttcattgtgcaaattagcaatatcattaatgctgtcaaagcacaaaat
attatttcacatattgtttataacaagttagatgaggtttgggatgaagatgcaatattt
gccaataatgatatccaaggtattatggggcaaaatgtattcgatgcaaaaaaacatctt
tatgataaagttcgtgttgattctgaagttgagaaacgctttgctagcgaactagatgtt
gaacagaatgttgaaatgtatgttaaattacctggtgggttctatattaatacgccagta
ggtaaatacaatcctgattgggcgattgtcttaaacgaacccgatcagaagcacgtctat
tttattgccgaaaccaaaggcgtttcagaaaatattgaactaagtttaaaaggtgttgaa
aatgctaaaatcgaatcagcacgtcagcattttaaaatcatttcaaatagcgaagtgacc
tatgatgtagtcgatagctatgaaaaaatgatggataaattatcttcaaacatctaa

DBGET integrated database retrieval system