KEGG   Lactococcus lactis subsp. lactis Il1403: L0006Help
Entry
L0006             CDS       T00045                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    L0006 (tpiA)
   01230 Biosynthesis of amino acids
    L0006 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L0006 (tpiA)
   00051 Fructose and mannose metabolism
    L0006 (tpiA)
   00562 Inositol phosphate metabolism
    L0006 (tpiA)
Enzymes [BR:lla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     L0006 (tpiA)
Exosome [BR:lla04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   L0006 (tpiA)
  Exosomal proteins of bladder cancer cells
   L0006 (tpiA)
  Exosomal proteins of melanoma cells
   L0006 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
1148515..1149273
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSEL
KLAAENSYFENAGAFTGENSPAAIVDLGVEYIIIGHSERREYFHETDEDINKKAKAIFAA
GATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLSAEQVSNLVIAYEPIWAIGTGKTAT
NEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLE
ADSFLALLEMYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattatcgctggtaactggaaaatgaacaaaactttgtcagaagcg
caagcttttgttgaagctgtaaaaaataacttgccttcatctgataatgttgaatcagtt
atcggtgcacctgcacttttcctcgctcctatggcttaccttcgtcaaggttcagaattg
aaacttgctgctgaaaatagctactttgaaaatgctggagcgttcactggtgaaaatagt
ccagctgctatcgttgatttaggtgttgaatacatcatcatcggtcacagcgaacgtcgt
gaatatttccacgaaactgacgaagacatcaacaaaaaagcaaaagcaatcttcgctgct
ggagcaactccaatcctttgttgtggtgaaactttggaaacttttgaagctggaaaaaca
gctgaatgggtttcaggtcaaatcgaagctggtcttgctggcttgagtgctgaacaagtt
tcaaacttggttattgcttatgaaccaatctgggcaatcggaactggtaaaactgcaaca
aacgaaatcgctgatgaaacttgtggtgttgttcgttcaacagttgaaaaactttacgga
aaagaagtttcagaagctgtacgtatccaatacggtggttcagttaaacctgaaacaatc
gaaggattgatggctaaagaaaacatcgacggtgccctcgttggtggagcttcacttgaa
gctgatagcttccttgcattgcttgaaatgtacaaataa

DBGET integrated database retrieval system