KEGG   Lactococcus lactis subsp. lactis IL1403: L0014Help
Entry
L0014             CDS       T00045                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lla00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1271961..1273457)
Genome map
AA seq 498 aa AA seqDB search
MTETSYIMAIDQGTTSSRAIIFDKHGKHIGSSQKEFTQYFPKEGWVEHDANEIWNSVQSV
IAGAFIESGIKPVQVAGIGITNQRETTIIWDKKTGKPIYHAIVWQSRQSADIANGLKEAG
HEELFHKKTGLIVDSYFSATKIRWILDHVEGAQERAERGELLFGTIDTWLLWKLTDGDAH
YTDYSNASRTMLYNIHELKWDEEILKILNIPASMLPEVKSNSEVYGVTKGFHFFGSEVPI
SGMAGDQQAALFGQMAFEPGMIKNTYGTGSFIVMNTGEKPHISKNNMLTTIGYGINGKVY
YALEGSIFVAGSSIQWLRDGLKMLERASDSEEVALQSRSQDEVYVVPAFVGLGAPYWDQE
ARGAMFGLTRGTTKEDIVKATLQGIAYQVRDVVSTMKEDTGIDMSVLKVDGGAANNEYLM
QFQADILNIPIQRAGDLETTALGAAFLAGLAVGFWKDLEELKESYEPGKIFQTQMQEERR
EELYAGWKKAVNATRAFK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacttcttacattatggcaattgaccaaggtacaacaagctcaagagctatt
atatttgataaacatggtaaacatatcggcagctcccaaaaggaatttacacagtacttt
cctaaagaaggttgggtggaacatgatgccaacgaaatttggaactctgttcagtctgtt
atcgcaggggcttttatcgagtcggggattaagcctgtacaggttgcgggtatcggtatt
actaaccaacgtgaaactaccattatatgggacaagaaaacaggaaaaccaatctatcat
gctattgtttggcaatctcgtcaatctgccgatattgccaatggtcttaaagaagcagga
catgaggaactcttccataaaaagacaggacttattgtcgattcatatttttcagccaca
aaaattcgttggatccttgaccatgtcgaaggagcacaagagcgtgcagaacgcggagag
ctcctctttggaaccatcgatacatggctcttgtggaagttgacagatggtgatgcacac
tatactgactattctaatgccagccgtaccatgctctacaacattcatgagttgaaatgg
gacgaagaaatcctgaaaattcttaatatcccagcttcaatgcttccagaagtcaagtcc
aactcagaagtttacggcgtgactaaaggtttccatttctttggctctgaagtgccaatc
tcaggtatggcaggggaccagcaagctgcattatttggtcaaatggcctttgaacctgga
atgattaaaaatacctatggtacaggttcgtttatcgtcatgaacacaggtgagaaacca
catatttcgaaaaataatatgcttacaacgattggttatggcattaatggaaaagtttat
tacgccttagaaggaagcatctttgttgcggggtcctctatccaatggttacgtgatggt
ttgaaaatgttggaacgtgccagtgattccgaagaagtggcactccagtctaggagtcaa
gatgaagtttatgtggtgccagcttttgtcggccttggtgctccgtattgggaccaagag
gcgcgtggtgcgatgtttggcttgacacgtggaacaacaaaagaagatattgtgaaagca
accttacaagggatagcttatcaagttcgtgatgtagtcagcaccatgaaagaagataca
ggaattgatatgtctgtgctcaaggtagacggtggcgctgcaaacaatgaatatttgatg
cagttccaagctgatatcttgaatatcccaatccaacgtgcgggagatttggaaacgaca
gcacttggtgcagccttccttgcaggacttgccgttggtttctggaaagacttagaagag
cttaaagaatcctatgaaccgggcaaaattttccaaactcagatgcaagaagaacgtaga
gaagaactctatgccggttggaaaaaagccgtgaatgcgacacgtgctttcaaataa

DBGET integrated database retrieval system