KEGG   Lactococcus lactis subsp. lactis Il1403: L0025Help
Entry
L0025             CDS       T00045                                 

Gene name
lacZ
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    L0025 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    L0025 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    L0025 (lacZ)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     L0025 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(2055179..2058175)
Genome map
AA seq 998 aa AA seqDB search
MAMMTMIDVLERKDWENPVVSNWNRLPMHTPMDLLEKQSLNGLWNFDHFSRISDVPKNWL
ELTESKTEIIVPSNWQIEFKDKSDVPIYTNVTYPIPIQPPYVPEANPVGAYSRYFDITKE
WLESGHVHLTFEGVGSAFHFWLNGEYGGYSEDSRLPAEFDISNLAKEGQNCLKVLVFRWS
KVTYFEDQDMWRMSGIFRSVNLQWLPDNYLLDFSIKTDLDEDLDFANVKLQAYAKNIDDA
CLEFKLYDDEQLIGECHGFDAEIGVVNPKLWSDEIPYLYRLELTLMDRSGAVFHKETKKI
GIRKIAIEKGQLKINGKALLVRGVNKHEFTPEHGYVVSEEVMIKDIKLMKEHNFNAVRCS
HYPNDSRWYELCDEYGLYVMDEANIETHGMTPMNRLTNDPTYLPLMSERVTRMVMRDRNH
PSIIIWSLGNESGYGSNHQALYDWCKSFDSSRPVHYEGGDDASRGATDATDIICPMYARV
DSPSINAPYSLKTWMGVAGENRPLILCEYAHDMGNSLGGFGKYWQAFREIDRLQGGFIWD
WVDQGLLKDGNYAYGGDFGDKPNDRQFSLNGLVFPNRQAKPALREAKYWQQYYQFELEKT
PLGQVFAFTVTNEYLFRSTDNEKLCYQLINGLEVLWENELILNMPAGGSMRIDLSELPID
GTDNLFLNIQVKTIEKCNLLESDFEVAHQQFVLQEKINFTDRIDSNEEITLFEDEELLTV
RSAKQKFIFNKSNGNLSRWLDEKGNEKLLHELSEQFTRAPLDNDIGVSEVEHIDPNAWLE
RWKGIGFYELKTLLKTMIIQATENEVIISVQTDYEAKGKIAFSTIREYHIFRNGELLLKV
DFKRNIEFPEPARIGLSLQLAEKAENVTYFGLGPDENYPDRRGASLFGQWNLRITDMTTP
YIFPSENGLRMETRELNYDRLKVRAMGQSFAFNLSPYSQNQLAKKGHWHLLEEEAGTWLN
IDGFHMGVGGDDSWSPSVAQEYLLTKGNYHYEVSFKLT
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatgacaatgattgatgtactagagcgtaaagattgggaaaatccagtagtt
tcaaattggaataggttgccaatgcatacacctatggacttgttagaaaagcaatcactg
aatggtctttggaattttgatcatttttctagaatttcagatgtacctaaaaattggtta
gaactgacggagagtaaaacggaaattatcgttccaagtaattggcaaatagaatttaag
gataaaagcgatgttccaatttatacaaatgtgacttatcctattccaattcagcctcct
tatgtaccagaggctaacccagttggagcttatagtcgctattttgatatcacaaaagaa
tggcttgagagcggtcatgttcaccttacatttgaaggggttggatcagcttttcatttt
tggttgaatggggaatacggaggttattcagaagatagccgcttgcctgctgaattcgat
atcagcaacctggccaaagaaggtcaaaattgtttaaaagttctagtttttcgttggtca
aaagtcacctattttgaagatcaagatatgtggcgaatgtcaggtatttttcgttcggtg
aacttacaatggcttccagataactacttgttagacttttctataaaaacagatttggat
gaggatttagattttgcaaatgtaaaacttcaagcatatgctaaaaacatcgatgatgct
tgtttagaatttaagctttatgatgacgaacaattaattggagagtgtcatggttttgat
gcagaaattggagtagtcaatccaaaattatggtcagatgaaattccctatctttatcgt
ttagaattaactttaatggaccggagtggggcggtatttcataaagaaacaaaaaaaatt
ggtattcgaaaaattgctattgaaaaaggacagctaaaaataaacgggaaagcacttctt
gttcgtggagtgaataagcacgaatttacccctgagcatggttatgtcgtttctgaagaa
gtgatgattaaagacatcaaattgatgaaagaacataattttaatgcggtccgctgctct
cattatcctaatgattcacgctggtatgaattgtgtgatgaatatggattgtatgttatg
gatgaagcaaatatcgaaacgcatggaatgactccgatgaatcgtttgacaaatgatccg
acttatttaccattaatgagtgaacgtgttacacgaatggttatgcgtgaccgtaatcat
ccatcaattattatttggtctcttgggaatgagtcaggttatggaagtaaccatcaagct
ttatatgattggtgtaaatcatttgattctagccgccctgttcattatgaggggggagat
gacgcaagtagaggagcaacagatgccactgatatcatttgtccgatgtatgctagagta
gatagtccaagtattaatgcgccttattcattaaaaacctggatgggggtagctggagag
aatagaccactaattctttgtgaatatgctcatgatatggggaattcattaggaggattt
gggaagtactggcaagcttttcgagaaattgaccgattgcaaggtggattcatctgggat
tgggtggatcaaggtttattaaaagatggaaattatgcttatggaggtgactttggggac
aagccaaatgatcgtcagtttagccttaatggtcttgtttttccaaatcgtcaagcaaaa
ccagctcttcgtgaagcaaaatattggcaacaatattatcagtttgaattggagaaaact
ccactaggtcaagtttttgcctttacagttacaaatgagtatctatttcgaagtactgac
aatgaaaaattatgttaccaactgatcaatggcttagaagtattatgggaaaatgagctt
atattgaatatgcctgctggagggtctatgagaatagacctgtctgagttgcctattgat
ggaacagataatttatttttgaacattcaagttaaaacaattgagaaatgtaatcttctt
gagtctgattttgaagttgctcatcaacaatttgttctacaagaaaaaattaattttact
gacagaatagatagtaatgaagaaattacactttttgaggatgaagagctactgaccgta
cgatcagcaaaacagaaatttatttttaataaaagcaatggtaatctctcgcgctggctt
gatgagaaaggcaatgaaaagttactgcatgagctctcagaacaatttacaagggctcca
ttagataatgatattggtgttagtgaagttgaacatattgatcctaatgcttggttagaa
cgttggaagggtattggcttttatgagttaaaaacgcttttgaaaactatgataatacaa
gcaacagagaatgaagtaattatttctgtccaaacagactatgaagcaaaaggaaaaatt
gcattttcaaccattcgagaatatcatatttttagaaacggtgaacttcttttaaaagtt
gattttaaaagaaatatagagtttccagaaccagctcgaattggcttgagtcttcaacta
gctgaaaaagcagaaaatgttacatattttggacttggcccagatgaaaattatcctgac
cgaagaggggcaagtttatttggccagtggaatttaaggattactgatatgacaacccct
tatatttttcctagtgaaaatgggttgaggatggaaaccagagagttaaattatgatcgt
ttaaaagttcgggcaatgggtcaatcttttgcttttaatctaagtccgtatagtcaaaac
cagcttgctaaaaagggacattggcatctacttgaagaagaagcaggaacatggttaaat
attgacggattccatatgggtgtaggtggagatgattcatggagtccaagtgtcgctcag
gaatatttattgacaaagggaaattatcattatgaagttagttttaaattaacgtga

DBGET integrated database retrieval system