KEGG   Lactococcus lactis subsp. lactis IL1403: L0029Help
Entry
L0029             CDS       T00045                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lla00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lla00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2061725..2062744)
Genome map
AA seq 339 aa AA seqDB search
MEIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAY
PGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQV
KFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDAS
ESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVK
GIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGG
ITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaataagagattttggcttaggaagtgacttaattagtctaaccaataaa
gcaggtgtcacaatttcttttacaaatctgggcgctcggattgttgactggcaaaaagat
ggaaagcatctgattctaggctttgattcagctaaagaatatttagaaaaagatgcctat
cctggtgcaactgttggacctacagcaggaagaattaaggatggtttggtcaaaatttct
gggaaagattatatcttaaatcaaaatgaaggccctcaaaccttacatggtggggaagaa
agtattcatactaaactttggacatatgaagttaccgatttaggagctgaagttcaagtc
aaattttccttagtttctaatgacggaacaaatggttatcctggtaaaatagaaatgtca
gtaactcattcttttgatgatgacaataagtggaaaattcattatgaggccatttctgat
aaagacactgtgtttaatccaactgggcatgtctattttaatttgaatggtgatgctagt
gaatctgttgaaaatcatggacttcgactggccgcttcaagatttgttcctttaaaagac
caaacagaaattgttcgtggtgatatcgttgatataaaaaatacagacttggatttccgt
caggaaaaacaattatcaaatgccttcaattctaatatggaacaagttcaattagttaaa
ggaattgaccatcctttcttgttagaccagttaggacttgataaagaacaagctcgttta
acgcttgatgatacttcaatttcagtctttaccgaccaaccaagtattgtgatatttaca
gcaaattttggtgatttaggaactctttatcatgagaaaaagcaagtgcaccatggtgga
attacttttgaatgtcaagtatcacctgggtctgagcaaattccagagcttggagatatc
agcctaaaagcgggagaaaaatatcaagcaaccacaatttacagcttgcatacaaaataa

DBGET integrated database retrieval system