KEGG   Lactococcus lactis subsp. lactis IL1403: L0035Help
Entry
L0035             CDS       T00045                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase component of PDH complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lla01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lla00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lla00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lla00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(60583..62181)
Genome map
AA seq 532 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEAGTTVEVDSPLVEFDGDGSGSSAAAPTPQETAGSDTATTDAPSGEAQIFTMPDIGEGM
HEGDIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLI
EYNGNGAAPAAASPAPVAEAPKAASPASPANAPLTKTTSTGHILAMPSVRHYARKAGIDL
SQVPATGRHGHTTLADVKAFESGSVAPIAQTTPEAAPAPKADKPAAPVAEKAPSVKAGAG
DRREAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEIAAKQDIKLTYLA
YVAKALATTAHKFPDINASVDYEKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILE
IAKEIAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKE
PIVNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggagacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgacccaattgctgaagtacaa
aatgataaacttatgcaagaaattctctctccttattctggtaccgtaacaaaacttttc
gttgaagctggaacaaccgtagaagttgattctcctttggttgagtttgatggtgacggt
tcaggctcttctgcagctgctcctactcctcaagaaacagctggttctgatactgctaca
actgatgcaccttctggagaagctcaaatcttcacgatgcctgatattggtgaaggaatg
catgaaggagatatcgccaactggttagttaaagttggagatgaaattaaagaagatgat
cctgttgcagaggttcaaaatgataaactcatgcaagaaattctttctccatattctgga
aaagtcactaaacttttcgttgaagctggaacgactgtagaagttggggctcctttaatt
gaatacaatggaaatggggctgctccagcagctgctagtcctgctccagtcgcagaagca
cctaaagcagctagtcctgcaagtcctgcaaatgctccattgactaaaacaacttctact
ggtcacattcttgcgatgccttctgttcgtcattatgcacgcaaggctggtattgattta
agtcaagttcctgcaactggtcgtcacggtcacacaacgttggccgatgttaaagctttt
gaatctggcagtgtcgctcctatcgctcaaacaacaccagaagccgctccagcacctaag
gctgataaaccagctgctcctgttgctgaaaaagcgccaagcgttaaagcaggagctggt
gatcgacgtgaagcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaa
catacacacattccaccagtaacaaactttgaccaagttgaagtttctaaactcgtgaaa
catcgtgctgtctttaaagaaattgctgcaaaacaagatattaaattaacctatcttgct
tatgttgctaaagctttggctactactgctcataaattcccagatatcaatgcttctgtt
gactatgaaaaacaagaaattgtttatcacgaacatgtcaaccttggaatcgctgtaaat
gctccaactggtttgtacgttccagtgattcatgaagctgaaactaaatcaattcttgag
attgctaaagaaatcgctgaattagctactgctacacgagaaggaacacttaaacctcaa
caaatgcaaggttcaacaattacaatttcaaatattggatctgctcgtggttcttggttt
acaccaatcattaatggttctgatgtcgtaattttaggactcggttcaatcgttaaagaa
ccaattgttaatggtgaaggcgaaattgttgtcggacaaaacatgaaattgtctatgact
tatgatcaccgtttgattgatggaatgttgggtcaaacatcacttaactacttgaaatct
ctattggctgaccctgagttcatgcttatggaaatctaa

DBGET integrated database retrieval system