KEGG   Lactococcus lactis subsp. lactis Il1403: L0035Help
Entry
L0035             CDS       T00045                                 

Gene name
pdhC
Definition
(RefSeq) dihydrolipoamide acetyltransferase component of PDH complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00010  Glycolysis / Gluconeogenesis
lla00020  Citrate cycle (TCA cycle)
lla00620  Pyruvate metabolism
lla01100  Metabolic pathways
lla01110  Biosynthesis of secondary metabolites
lla01120  Microbial metabolism in diverse environments
lla01130  Biosynthesis of antibiotics
lla01200  Carbon metabolism
Module
lla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L0035 (pdhC)
   00020 Citrate cycle (TCA cycle)
    L0035 (pdhC)
   00620 Pyruvate metabolism
    L0035 (pdhC)
Enzymes [BR:lla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     L0035 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N E3_binding HlyD_3 GCV_H ATP-synt_ab_Xtn DEC-1_N
Motif
Other DBs
NCBI-GeneID: 1113663
NCBI-ProteinID: NP_266216
UniProt: Q9CJD7
Position
complement(60583..62181)
Genome map
AA seq 532 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEAGTTVEVDSPLVEFDGDGSGSSAAAPTPQETAGSDTATTDAPSGEAQIFTMPDIGEGM
HEGDIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLI
EYNGNGAAPAAASPAPVAEAPKAASPASPANAPLTKTTSTGHILAMPSVRHYARKAGIDL
SQVPATGRHGHTTLADVKAFESGSVAPIAQTTPEAAPAPKADKPAAPVAEKAPSVKAGAG
DRREAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEIAAKQDIKLTYLA
YVAKALATTAHKFPDINASVDYEKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILE
IAKEIAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKE
PIVNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggagacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgacccaattgctgaagtacaa
aatgataaacttatgcaagaaattctctctccttattctggtaccgtaacaaaacttttc
gttgaagctggaacaaccgtagaagttgattctcctttggttgagtttgatggtgacggt
tcaggctcttctgcagctgctcctactcctcaagaaacagctggttctgatactgctaca
actgatgcaccttctggagaagctcaaatcttcacgatgcctgatattggtgaaggaatg
catgaaggagatatcgccaactggttagttaaagttggagatgaaattaaagaagatgat
cctgttgcagaggttcaaaatgataaactcatgcaagaaattctttctccatattctgga
aaagtcactaaacttttcgttgaagctggaacgactgtagaagttggggctcctttaatt
gaatacaatggaaatggggctgctccagcagctgctagtcctgctccagtcgcagaagca
cctaaagcagctagtcctgcaagtcctgcaaatgctccattgactaaaacaacttctact
ggtcacattcttgcgatgccttctgttcgtcattatgcacgcaaggctggtattgattta
agtcaagttcctgcaactggtcgtcacggtcacacaacgttggccgatgttaaagctttt
gaatctggcagtgtcgctcctatcgctcaaacaacaccagaagccgctccagcacctaag
gctgataaaccagctgctcctgttgctgaaaaagcgccaagcgttaaagcaggagctggt
gatcgacgtgaagcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaa
catacacacattccaccagtaacaaactttgaccaagttgaagtttctaaactcgtgaaa
catcgtgctgtctttaaagaaattgctgcaaaacaagatattaaattaacctatcttgct
tatgttgctaaagctttggctactactgctcataaattcccagatatcaatgcttctgtt
gactatgaaaaacaagaaattgtttatcacgaacatgtcaaccttggaatcgctgtaaat
gctccaactggtttgtacgttccagtgattcatgaagctgaaactaaatcaattcttgag
attgctaaagaaatcgctgaattagctactgctacacgagaaggaacacttaaacctcaa
caaatgcaaggttcaacaattacaatttcaaatattggatctgctcgtggttcttggttt
acaccaatcattaatggttctgatgtcgtaattttaggactcggttcaatcgttaaagaa
ccaattgttaatggtgaaggcgaaattgttgtcggacaaaacatgaaattgtctatgact
tatgatcaccgtttgattgatggaatgttgggtcaaacatcacttaactacttgaaatct
ctattggctgaccctgagttcatgcttatggaaatctaa

DBGET integrated database retrieval system