KEGG   Lactococcus lactis subsp. lactis Il1403: L0048Help
Entry
L0048             CDS       T00045                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    L0048 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L0048 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    L0048 (trpA)
Enzymes [BR:lla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     L0048 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1493956..1494717)
Genome map
AA seq 253 aa AA seqDB search
MKTLQMTLSNKKNNFIPYIMAGDHEKGLEGLKETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALARNVSLSSILETLKTIDTKVPLVIMTYFNPVYQFGIEKFVAALEKTPVKG
LIIPDLPKEHEDYIKPFINDKDICLVPLVSLTTPLSRQKELVADAEGFIYAVAINGVTGK
ENAYSNQLDQHLKALSSLTDVPVLTGFGISTLSDVDRFNKVSSGVIVGSKIVRDLHEGKE
NEVIKFIENAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaaatgactttaagcaataaaaaaaataattttattccttatatcatg
gctggcgaccatgaaaaaggcttagaaggtcttaaagaaaccattcaactgcttgagcaa
gctgggagttccgctattgaaattggcgttccattttcagatccggttgctgatggtcca
gtcatcgaacaagcaggtttgcgtgcgttagcaagaaatgtatcactttcaagtattctt
gaaaccttaaaaacaattgatacaaaagttcctctagtaattatgacctatttcaatccc
gtttatcagtttggaattgaaaagtttgttgcagctcttgaaaaaacaccagttaaaggc
cttatcattcctgatttgcctaaagaacatgaggactatatcaaaccatttatcaatgat
aaagatatctgtttagttcctctggtctcattaaccacgccactttctcggcaaaaagaa
cttgtagccgatgctgaaggatttatctatgccgttgcaataaatggagtaactgggaaa
gaaaatgcttatagtaaccagcttgaccaacatttaaaagcgttatcttcattaacggat
gttcctgttttgacaggatttggaatttctacattatctgatgtggaccgttttaataaa
gtgtcctcaggagttattgttggttcaaaaattgttcgtgatttacatgaaggtaaagaa
aacgaagttattaaatttattgaaaacgcaatcaatttttaa

DBGET integrated database retrieval system