KEGG   Lactococcus lactis subsp. lactis Il1403: L0067Help
Entry
L0067             CDS       T00045                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
lla00340  Histidine metabolism
lla01100  Metabolic pathways
lla01110  Biosynthesis of secondary metabolites
lla01230  Biosynthesis of amino acids
Module
lla_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    L0067 (hisD)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     L0067 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF4735 Med11
Motif
Other DBs
NCBI-GeneID: 1114856
NCBI-ProteinID: NP_267365
UniProt: Q02136
Position
1231329..1232624
Genome map
AA seq 431 aa AA seqDB search
MLKQIDYQGKLEEIAEKFQGRKTELSKEVNKTVQQIVEDIQKSGDTALFNYAKKFDGYDV
NTSNLLVTPMERETGLEQIDEDYFRILRRTKSQIEEFHKHQLGNSWNIFKENGVIMGQIA
RPLERVALYVPGGTAAYPSTVIMNAVPALLAGVKEIIMITPVKTDGKVNPNILAAAEVCG
IETIYKVGGAQGVAAVAYGTESIPKVDKIVGPGNIFVATAKKICYGVVDIDMIAGPSEVL
VIADETANPKYIAADLMAQAEHDKLASAILVTTSEKLVQQVDEELNRQVQNLERSEIIES
YISNYGGAIVVKNIDEAFDVSNQLAPEHLEVLTSEPLTQLPKIKNAGSIFIGEYTPEPLG
DYMSGSNHVLPTGGTAKFYSGLGVYNFIKYLTYSYYPKEVLAAFKEDVETFAKSEGLTAH
ANSISVRFDEM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaattgattatcaaggaaagcttgaagaaattgctgaaaaatttcaaggt
cgaaaaacagaactatcaaaagaagttaataaaactgttcaacagattgtagaagacatt
caaaaaagtggagatactgccttatttaactatgctaaaaagttcgatggttatgatgtg
aatactagtaatttactcgtcacgcccatggaacgtgaaacaggactagaacaaattgat
gaggattattttagaattcttagacgcaccaaatcacaaatcgaagaatttcataagcac
caactgggaaattcatggaatatttttaaggaaaatggtgttatcatgggacaaattgcg
cgtcctctggaacgtgttgctctctatgttcccggaggaacggctgcatatccctcaaca
gtcattatgaatgctgttccagcgcttttagcaggcgtcaaagaaattattatgattact
ccagttaaaactgatggaaaagtaaatcctaatattttagcagctgctgaagtttgtgga
atagaaacaatctataaagtgggtggagcacaaggcgttgctgccgttgcgtatgggaca
gaatctattcctaaagttgataagattgtcggacctggaaatatttttgtagctacagct
aagaaaatctgttatggggtggtagatattgatatgattgccggtccgtcagaagttcta
gttattgctgacgaaactgccaatccaaagtatattgctgctgatttaatggcgcaagca
gaacatgataaacttgcgtcagcgattttagtgacgacttctgaaaaacttgttcaacaa
gtagatgaggaattaaatagacaagttcaaaatttggaacgtagtgaaatcattgaaagt
tacatcagtaattacggtggagccattgttgtaaaaaatattgatgaagcctttgatgtt
tccaatcagctggctccagaacatttagaagttttgactagtgaacctttaacccaactt
ccaaaaatcaaaaatgctggctcaatttttattggagagtatacgccagaaccgttaggc
gactatatgtcaggaagcaatcatgtcttaccaactggaggaacagccaaattttactct
ggtttgggtgtttataattttataaaatatttgacttatagctattatcctaaagaagtt
ttggctgcttttaaagaggatgttgagacatttgcaaaatcagaaggattgacggctcat
gctaactcaatttctgtgagatttgatgaaatgtaa

DBGET integrated database retrieval system