KEGG   Lactococcus lactis subsp. lactis IL1403: L0176Help
Entry
L0176             CDS       T00045                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lla00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
1167233..1168306
Genome map
AA seq 357 aa AA seqDB search
MKILELNQESFSLKNIILKFDELNHNEMISLQKKLYRNGSLTRLAPDSLLVVLTIDDLAK
LINLFENDEDKKMLEVIYKRHQIIWSGKNFNFDLTRKSIVYSIVNVTPDSFYDGNPDNLN
LSHILKRVEADLENGASVLELGGKSSKPGYDDISPEEEWNRLKEPILELKKNFPKAIFAV
DTDEAYVMERVLDAGVDIINDIDGFDTNDKLKVVEKYQPALVAMNNGRAGFSYADNVYEE
LPLFFENKKEELLQLGLKAEQIVIDPGVGFFNGDSGSDSLERVKATEILSRIGLPLMIAI
SRKSFMGKLFNAQGDERLFSSLVLEAQMVADGGRILRVHDVKETKRLLDAIEIYKEF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttagaacttaatcaagaatctttttctcttaaaaatattatcctaaaattt
gatgagttaaatcacaatgaaatgatttctcttcaaaaaaaactttatcgaaatggtagt
ttgacaagactggctccagactccttgttagtagttttaacaattgatgacttagcaaaa
ttgattaatctttttgaaaatgatgaagataaaaaaatgcttgaagtgatttataagcgt
catcaaatcatttggtcaggtaaaaatttcaattttgatttaactagaaagtcaattgtc
tattcaatcgtcaatgttacaccagactctttttatgatggaaatccagataatttaaac
ctctctcatattttaaaaagagtagaagctgatttagaaaatggagcttctgttcttgag
ctgggagggaaatcatcgaaaccaggatatgacgatattagcccagaagaggaatggaac
agactgaaagaacctattcttgagttgaaaaaaaactttcctaaagcgatttttgctgtc
gatacggatgaagcttatgtcatggaacgagttttagacgctggggttgatattattaac
gatattgatggttttgatacaaatgataaattaaaagtggtagaaaagtatcaaccggct
ttagttgctatgaataatgggcgagctggttttagttatgctgataatgtttatgaagaa
cttccattattttttgaaaataaaaaagaagagttacttcaacttggtttaaaagctgag
caaatcgttattgatcctggagttggtttttttaatggagattcaggttcagatagtctt
gagcgggttaaagcaactgaaattttaagcagaataggtttacctcttatgattgcaatc
tctcgtaagtcatttatgggaaaactcttcaatgcccaaggagatgagcggcttttttca
agccttgtcctagaagcgcaaatggttgctgatgggggacggattttgcgtgttcatgat
gttaaggagactaaacgtttactcgatgcaattgaaatttataaggaattttaa

DBGET integrated database retrieval system