KEGG   Lactococcus lactis subsp. lactis Il1403: L0230Help
Entry
L0230             CDS       T00045                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    L0230 (xylA)
   00051 Fructose and mannose metabolism
    L0230 (xylA)
Enzymes [BR:lla01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     L0230 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1549053..1550372)
Genome map
AA seq 439 aa AA seqDB search
MAYFNDIAPIKYEGTKTKNMFAFRHYNPEEVVAGKTMEEQLHFALAFWHTITMDGSDPFG
GATMERPWDLEGGSELDRAHRRVDAFFEIAEKLGVKYYCFHDIDIAPTGNSLKEFYANLD
EITDHLLEKQKATGIKLLWNTANMFSNPRYMNGVSTSNRAEVFAYGAAQVKKGLELSKKL
GGENYVFWGGREGYESLLNTDRGLEMDHMAKFFHLAIDYAKSINHLPIFLIEPKPKEPMT
HQYDFDAATALAFLQKYDLDKYFKLNLETNHAWLVGHTFEHELNTARTFNALGSIDANQG
NYLLGWDTDEFPTLVIDITLAMHQILLNGGLGKGGINFDAKVRRTSFKAEDLILAHIAGM
DTYARALKGAAAIIEDKFLSDIVDERYTSYKNTEVGQSIENGTATFESLAAFALEHGDDI
ELDSNHLEYIKSVLNDYLV
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcttactttaacgacatcgcacctatcaaatacgaaggtacaaaaactaaaaatatg
tttgcctttcgccattataatccagaagaagtagttgctggtaaaacaatggaagaacaa
cttcattttgcccttgcattttggcatacaattacaatggatgggtcagacccctttggg
ggagcaacaatggaacgtccttgggatttggaaggtggttctgaacttgaccgtgctcac
cgtcgagtagatgctttctttgaaattgctgaaaaattaggtgttaaatattattgtttc
catgatattgatattgcacctactggaaattctttgaaagaattttatgctaatttggac
gaaattactgaccaccttcttgaaaaacaaaaagcaacagggattaaattactttggaat
acagcaaacatgttttcaaatccccgctatatgaatggtgtttcaacttctaaccgtgct
gaagtctttgcttatggtgctgcacaagttaaaaaaggtcttgaactttctaaaaaactc
ggtggcgaaaattatgtcttctggggtggtcgtgaaggttatgaatcacttttgaacaca
gataggggtcttgaaatggaccacatggcaaaattcttccatttggcaattgattatgca
aaatcaatcaaccacttgcctattttcttgattgaaccaaaaccaaaagaaccaatgact
caccaatatgattttgacgcagcaacagctcttgctttcttgcaaaaatatgatttggac
aaatatttcaaactcaatcttgaaacaaatcatgcttggcttgttggtcacacttttgaa
cacgaattaaatactgcacgtactttcaatgctttgggttctattgatgccaatcaagga
aattacttgcttggttgggatacagatgaattcccaacacttgttattgatatcacactt
gcgatgcaccaaattcttttgaacggtggacttggcaaaggtggaattaactttgatgcg
aaagtacgtcgtacaagtttcaaagcagaagatttaattcttgctcatattgcagggatg
gatacttatgcgcgtgctttgaaaggtgcagcagcaatcattgaagataaattcttgtct
gatattgttgacgaacgttatacttcatacaaaaatacagaagttggtcaatccattgaa
aatggaacagcaacttttgaaagtcttgccgcatttgcacttgaacatggtgacgatatt
gaacttgattctaatcacttggaatacatcaaatcagtattgaatgactatcttgtttaa

DBGET integrated database retrieval system