KEGG   Lactococcus lactis subsp. lactis IL1403: L0265Help
Entry
L0265             CDS       T00045                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lla03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
340013..340609
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLSFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKTLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEITLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcctgaacctattgctcgcctgattgagtcgttttcaaaattaccagggatt
ggtcaaaaaacagcgactcgattggctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcaaaaaatcttctttcagcaaaacgggatttgagtttttgctcgatttgt
gggaatttaacagaaagtgatccttgcgccatttgtaccgacccaacgcgtgatcgaaca
actatattggtcgttgaagaatctaaagatgttcttgctatggaaaaaattcgggaatat
cgaggactttatcatgttttgcatggtacgattagtccaatgaatgggatttctcctgat
gaaattaatgttaaaacattgattacaagattaatggattcagaggttaaagaagtgatc
atcgcaactaatgccacttctgacggagaagcaaccgccatgtatctggctcgaatgatt
aagcctgcaggaattaaagtgactcgcttggctcgtggattagctgtaggctctgatata
gaatacgcagatgaaattactttatcaaaagcggtagagaatcggttggaaatttga

DBGET integrated database retrieval system