KEGG   Lactococcus lactis subsp. lactis Il1403: L0266Help
Entry
L0266             CDS       T00045                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lla00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    L0266 (ruvA)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     L0266 (ruvA)
DNA repair and recombination proteins [BR:lla03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     L0266 (ruvA)
    RecFOR pathway proteins
     L0266 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2289550..2290143)
Genome map
AA seq 197 aa AA seqDB search
MFEYLNGKLVKISPTNIVIDVAGIGYLISVANPYAWSALMNTEVKIYVHQVIREDAHSLY
GFVNEAEKALFLRLISVSGIGPKSALAIIAAADNEGLITAIDNSDIKYLTKFPGVGKKTA
MQMVLDLAGKFDATGTVGISLLDAGPAGNLALEEAIEALQALGYKATELKKIEKKLAQET
GLTSEEYIKSALKLMMK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatcttaatggaaaattagtaaaaatttccccaacaaatattgtaattgat
gtagcaggaattggttatcttatcagtgtagctaacccttacgcttggtctgctttgatg
aacacagaagtaaaaatttatgttcatcaagtcattcgcgaagatgcccacagcctctat
ggttttgttaacgaggccgaaaaagctttattcttacgtctgatcagcgtttctgggatt
gggccaaaatcagctctggccatcattgcggcggctgataacgaaggtttaatcactgct
attgacaatagtgatatcaagtatttaactaaatttccaggagttggtaaaaaaacagcc
atgcagatggtgcttgatttggctgggaaatttgatgcgacaggaactgtaggtatttct
cttcttgatgctggacctgctggcaatcttgctttggaagaagcgattgaagcgctgcaa
gctttgggttataaagcaacagaattgaagaaaattgagaaaaaattagctcaagaaaca
ggtctgaccagcgaagaatatatcaaatcagccttaaaacttatgatgaaataa

DBGET integrated database retrieval system