KEGG   Lactococcus lactis subsp. lactis Il1403: L0266Help
Entry
L0266             CDS       T00045                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lla00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    L0266 (ruvA)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     L0266 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2289550..2290143)
Genome map
AA seq 197 aa AA seqDB search
MFEYLNGKLVKISPTNIVIDVAGIGYLISVANPYAWSALMNTEVKIYVHQVIREDAHSLY
GFVNEAEKALFLRLISVSGIGPKSALAIIAAADNEGLITAIDNSDIKYLTKFPGVGKKTA
MQMVLDLAGKFDATGTVGISLLDAGPAGNLALEEAIEALQALGYKATELKKIEKKLAQET
GLTSEEYIKSALKLMMK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatcttaatggaaaattagtaaaaatttccccaacaaatattgtaattgat
gtagcaggaattggttatcttatcagtgtagctaacccttacgcttggtctgctttgatg
aacacagaagtaaaaatttatgttcatcaagtcattcgcgaagatgcccacagcctctat
ggttttgttaacgaggccgaaaaagctttattcttacgtctgatcagcgtttctgggatt
gggccaaaatcagctctggccatcattgcggcggctgataacgaaggtttaatcactgct
attgacaatagtgatatcaagtatttaactaaatttccaggagttggtaaaaaaacagcc
atgcagatggtgcttgatttggctgggaaatttgatgcgacaggaactgtaggtatttct
cttcttgatgctggacctgctggcaatcttgctttggaagaagcgattgaagcgctgcaa
gctttgggttataaagcaacagaattgaagaaaattgagaaaaaattagctcaagaaaca
ggtctgaccagcgaagaatatatcaaatcagccttaaaacttatgatgaaataa

DBGET integrated database retrieval system