KEGG   Lactococcus lactis subsp. lactis IL1403: L0271Help
Entry
L0271             CDS       T00045                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lla03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
357841..358659
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETVRRELEKRIVGQKIVSIEATYPRMVLTGFEQLKKELTGKTIHGISRRGKYL
IFEIGEKDRLISHLRMEGKYRLASLNVPMEKHDHLALKFTDEQLIYADVRKFGTWELIST
DQVLPYFLKKNIGPEPTYETFDEQIFREKLQKSTKKIKPFLLEQTLVAGLGNIYVDEVLW
LAKIHPEKVANQLTESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQDELRVYG
KTGEKCVRCGNEIQKIKVAGRGTHFCPFCQQK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttaccagaagttgaaacagtgagaagagagcttgaaaaaagaattgttgga
caaaaaattgtatctatagaagccacttatccaagaatggttttaactggttttgagcaa
ttgaaaaaagaattgacaggaaaaaccattcatggcatttcacgtcgcggaaaatattta
atttttgaaattggcgagaaagatcgtttgatttctcatctgcggatggaaggaaaatat
cgacttgcaagtctcaatgttccaatggaaaaacatgaccatttagcccttaaatttact
gacgaacaattaatttatgctgacgtaagaaaatttgggacttgggaactgatttctact
gaccaagtccttccatattttttgaagaaaaacattggtccggagccaacttatgaaact
tttgatgaacagattttccgagaaaaattgcagaaatcgacaaagaaaattaaacctttt
ctacttgaacaaacattagtggctggacttggaaatatttacgttgatgaagtgctctgg
ctagcaaagattcatccagaaaaagtggcaaatcaactgacagaaagttctattcatctt
ttacatgattctatcattgaaattttgcaaaaagcaattaaattaggcggctcaagcatc
agaacttatagtgccttaggttcaacaggaaaaatgcaggacgaattacgagtgtatgga
aaaacaggggaaaaatgtgtgcgttgtggcaatgaaattcaaaaaataaaagtggctggt
cgggggacccacttttgcccattctgtcagcaaaaataa

DBGET integrated database retrieval system