KEGG   Lactococcus lactis subsp. lactis Il1403: L0352Help
Entry
L0352             CDS       T00045                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lla00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    L0352 (leuS)
Enzymes [BR:lla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     L0352 (leuS)
Amino acid related enzymes [BR:lla01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   L0352 (leuS)
Transfer RNA biogenesis [BR:lla03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    L0352 (leuS)
 Prokaryotic Type
    L0352 (leuS)
Mitochondrial biogenesis [BR:lla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    L0352 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
827445..829934
Genome map
AA seq 829 aa AA seqDB search
MEYNHQEIEAKWQKYWADNKTFRTGTDKNKPKFYALDMFPYPSGAGLHVGHPEGYTATDI
LSRYKRAQGFNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAENIANFKRQINSLGFSYDW
EREVNTTDPNFYKWTQWIFTKLYEKGLAYEAEVAVNWVEELGTAIANEEVLPDGTSERGG
YPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKEMQRNWIGKSVGADVTFEVAGTDK
SFEVFTTRPDTLFGATYAVLAPEHDLVDAITTPEQKEAVAEYRRKASLKSDLARTDLSKE
KTGAFTGAYAINPINGRKMPIWVADYVLASYGHGAVMAVPAHDERDWEFAKVYGLEILPV
VEGGNVEEAVYTEDGPHINSEFLNGLDKAQAIEKAIEFLEEKKIGKKKITYRLRDWLFSR
QRYWGEPIPIIHWEDGTSTALSEDELPLVLPVTSDIKPSGTGESPLANLTDWLEVTRADG
LKGRRETNTMPQWAGSSWYYLRYIDPNNSEALADPELLKEWLPVDIYVGGAEHAVLHLLY
ARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGGFYHMETG
EALEQAPAKMSKSLKNVVNPDDVVEHYGADTLRVYEMFMGPLDASIPWSEEGLEGARKFL
DRAVRMIENSEIKAENNGELDKVYNETVKNVTERLDLMYFNTAISQLMIFVNAVNKAKAL
PLEYANGFVQLLAPFAPHIAEELWVKLGNEAGISYVAWPTFDESKLIESEVEIVVQINGK
LKAKIKIAKDLAREELEKIGRESVAEALEGKNVVKVIAVPNKLVNIVVK
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaatcatcaagaaatagaagccaaatggcaaaaatactgggcggataacaaa
actttccgtacaggaacagataaaaataaaccaaaattttatgctctagatatgttccct
tatccatctggtgcaggacttcacgttggacacccagaaggttataccgcaactgatatt
ttgagccgttacaaacgcgctcaagggttcaatgttcttcatccaatgggctgggatgcc
tttggtttacctgctgaacaatatgcaatggatacaggaaatgacccagcagaatttaca
gctgaaaatattgctaactttaaacgtcaaatcaatagcttaggctttagttatgactgg
gaacgtgaagttaatacaactgacccaaatttttataaatggacacagtggatttttact
aaactttatgaaaaagggttagcttatgaagcagaagtagctgttaactgggttgaagaa
ctcggaacggctattgctaatgaagaagtgcttccagacggaacttctgaacgcgggggt
tatcctgttgttcgtaaaccaatgcgccaatggatgcttaaaattacagcttatgcggaa
cgtttacttgaagaccttgaagaagttgattggcctgaatcaatcaaagaaatgcaacgg
aattggatagggaaatcagtaggagcagatgtgacttttgaagttgcaggaaccgacaaa
tcatttgaagtctttacgactcgtcctgataccctttttggggcaacttatgctgtgctt
gcacctgaacatgatttagttgatgctattacgacacctgagcaaaaagaagctgttgct
gaataccgtcgcaaagcgagcttgaaatctgatttagcccgtacagacctttctaaagaa
aaaactggagcatttaccggagcttacgcgattaacccaattaatggccgtaaaatgcca
atttgggttgcagattatgttcttgcttcttatggacatggtgctgttatggcagttcct
gctcacgacgaacgtgactgggaatttgctaaggtctatggacttgaaattttgcctgtt
gttgaaggtggaaatgtagaagaagctgtttatacagaagatggccctcatattaattca
gaatttttgaatggacttgacaaagcacaagcgattgaaaaagccattgaatttttagaa
gaaaagaaaattgggaaaaagaaaatcacttaccgcttgcgcgactggctctttagtcgt
caacgttattggggtgaaccaattccaattattcattgggaagatggcacatcaacagcg
ctctcagaagatgaacttcctcttgttttaccagtaacctctgatatcaaaccgtcagga
actggtgagtctcctttggctaacttgacagattggttggaagtcacacgcgcagatggc
ctaaaaggtcgccgtgaaactaatacaatgccacaatgggcaggttcaagttggtattac
cttcgctatattgacccaaataatagcgaagctttggcagacccagaacttctcaaagaa
tggttgccagttgatatctatgtgggaggggctgaacatgctgttcttcacttactttac
gctcgtttctggcataaagtgctttatgatttaggagttgttccaactaaagaacctttc
caaaaactctttaaccaaggaatgattctcggaacctcttatcgtgatcatcgtggggcc
ttggttgcaactgataaggttgaaaaacgtgatggtggcttttaccatatggaaacaggt
gaagcccttgaacaagctccagctaaaatgtctaaatctcttaaaaatgttgttaatcct
gatgatgttgttgaacattatggagctgatactttacgtgtttatgaaatgttcatgggt
ccacttgatgcaagtattccatggtcagaagaaggccttgaaggggctcgtaaattccta
gaccgagctgttcgaatgattgaaaattcagagattaaagctgaaaataatggagagttg
gacaaagtttacaatgaaacagtgaaaaatgttactgagcgtttggacttgatgtacttt
aacactgcaatttcccaattaatgatttttgttaatgcagttaataaagcaaaagcttta
ccgttagaatacgctaatggctttgtccaacttttggcgccatttgcaccacatattgct
gaagaactttgggtaaaattaggtaatgaagctggaatttcttatgttgcttggccaaca
tttgacgaaagcaaattaattgaatcagaagttgaaattgttgttcaaattaatggtaaa
ttaaaagcaaaaattaaaattgctaaagatttagcgcgtgaagaacttgaaaaaattggt
cgtgaatcagttgctgaggctcttgaaggtaaaaacgtggtcaaagtaattgctgttcca
aataaattagttaatattgttgtaaaataa

DBGET integrated database retrieval system