KEGG   Lactococcus lactis subsp. lactis IL1403: L0352Help
Entry
L0352             CDS       T00045                                 

Gene name
leuS
Definition
leucyl-tRNA synthetase (EC:6.1.1.4)
Orthology
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lla00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
827445..829934
Genome map
AA seq 829 aa AA seqDB search
MEYNHQEIEAKWQKYWADNKTFRTGTDKNKPKFYALDMFPYPSGAGLHVGHPEGYTATDI
LSRYKRAQGFNVLHPMGWDAFGLPAEQYAMDTGNDPAEFTAENIANFKRQINSLGFSYDW
EREVNTTDPNFYKWTQWIFTKLYEKGLAYEAEVAVNWVEELGTAIANEEVLPDGTSERGG
YPVVRKPMRQWMLKITAYAERLLEDLEEVDWPESIKEMQRNWIGKSVGADVTFEVAGTDK
SFEVFTTRPDTLFGATYAVLAPEHDLVDAITTPEQKEAVAEYRRKASLKSDLARTDLSKE
KTGAFTGAYAINPINGRKMPIWVADYVLASYGHGAVMAVPAHDERDWEFAKVYGLEILPV
VEGGNVEEAVYTEDGPHINSEFLNGLDKAQAIEKAIEFLEEKKIGKKKITYRLRDWLFSR
QRYWGEPIPIIHWEDGTSTALSEDELPLVLPVTSDIKPSGTGESPLANLTDWLEVTRADG
LKGRRETNTMPQWAGSSWYYLRYIDPNNSEALADPELLKEWLPVDIYVGGAEHAVLHLLY
ARFWHKVLYDLGVVPTKEPFQKLFNQGMILGTSYRDHRGALVATDKVEKRDGGFYHMETG
EALEQAPAKMSKSLKNVVNPDDVVEHYGADTLRVYEMFMGPLDASIPWSEEGLEGARKFL
DRAVRMIENSEIKAENNGELDKVYNETVKNVTERLDLMYFNTAISQLMIFVNAVNKAKAL
PLEYANGFVQLLAPFAPHIAEELWVKLGNEAGISYVAWPTFDESKLIESEVEIVVQINGK
LKAKIKIAKDLAREELEKIGRESVAEALEGKNVVKVIAVPNKLVNIVVK
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaatcatcaagaaatagaagccaaatggcaaaaatactgggcggataacaaa
actttccgtacaggaacagataaaaataaaccaaaattttatgctctagatatgttccct
tatccatctggtgcaggacttcacgttggacacccagaaggttataccgcaactgatatt
ttgagccgttacaaacgcgctcaagggttcaatgttcttcatccaatgggctgggatgcc
tttggtttacctgctgaacaatatgcaatggatacaggaaatgacccagcagaatttaca
gctgaaaatattgctaactttaaacgtcaaatcaatagcttaggctttagttatgactgg
gaacgtgaagttaatacaactgacccaaatttttataaatggacacagtggatttttact
aaactttatgaaaaagggttagcttatgaagcagaagtagctgttaactgggttgaagaa
ctcggaacggctattgctaatgaagaagtgcttccagacggaacttctgaacgcgggggt
tatcctgttgttcgtaaaccaatgcgccaatggatgcttaaaattacagcttatgcggaa
cgtttacttgaagaccttgaagaagttgattggcctgaatcaatcaaagaaatgcaacgg
aattggatagggaaatcagtaggagcagatgtgacttttgaagttgcaggaaccgacaaa
tcatttgaagtctttacgactcgtcctgataccctttttggggcaacttatgctgtgctt
gcacctgaacatgatttagttgatgctattacgacacctgagcaaaaagaagctgttgct
gaataccgtcgcaaagcgagcttgaaatctgatttagcccgtacagacctttctaaagaa
aaaactggagcatttaccggagcttacgcgattaacccaattaatggccgtaaaatgcca
atttgggttgcagattatgttcttgcttcttatggacatggtgctgttatggcagttcct
gctcacgacgaacgtgactgggaatttgctaaggtctatggacttgaaattttgcctgtt
gttgaaggtggaaatgtagaagaagctgtttatacagaagatggccctcatattaattca
gaatttttgaatggacttgacaaagcacaagcgattgaaaaagccattgaatttttagaa
gaaaagaaaattgggaaaaagaaaatcacttaccgcttgcgcgactggctctttagtcgt
caacgttattggggtgaaccaattccaattattcattgggaagatggcacatcaacagcg
ctctcagaagatgaacttcctcttgttttaccagtaacctctgatatcaaaccgtcagga
actggtgagtctcctttggctaacttgacagattggttggaagtcacacgcgcagatggc
ctaaaaggtcgccgtgaaactaatacaatgccacaatgggcaggttcaagttggtattac
cttcgctatattgacccaaataatagcgaagctttggcagacccagaacttctcaaagaa
tggttgccagttgatatctatgtgggaggggctgaacatgctgttcttcacttactttac
gctcgtttctggcataaagtgctttatgatttaggagttgttccaactaaagaacctttc
caaaaactctttaaccaaggaatgattctcggaacctcttatcgtgatcatcgtggggcc
ttggttgcaactgataaggttgaaaaacgtgatggtggcttttaccatatggaaacaggt
gaagcccttgaacaagctccagctaaaatgtctaaatctcttaaaaatgttgttaatcct
gatgatgttgttgaacattatggagctgatactttacgtgtttatgaaatgttcatgggt
ccacttgatgcaagtattccatggtcagaagaaggccttgaaggggctcgtaaattccta
gaccgagctgttcgaatgattgaaaattcagagattaaagctgaaaataatggagagttg
gacaaagtttacaatgaaacagtgaaaaatgttactgagcgtttggacttgatgtacttt
aacactgcaatttcccaattaatgatttttgttaatgcagttaataaagcaaaagcttta
ccgttagaatacgctaatggctttgtccaacttttggcgccatttgcaccacatattgct
gaagaactttgggtaaaattaggtaatgaagctggaatttcttatgttgcttggccaaca
tttgacgaaagcaaattaattgaatcagaagttgaaattgttgttcaaattaatggtaaa
ttaaaagcaaaaattaaaattgctaaagatttagcgcgtgaagaacttgaaaaaattggt
cgtgaatcagttgctgaggctcttgaaggtaaaaacgtggtcaaagtaattgctgttcca
aataaattagttaatattgttgtaaaataa

DBGET integrated database retrieval system