KEGG   Lactococcus lactis subsp. lactis IL1403: L0386Help
Entry
L0386             CDS       T00045                                 

Gene name
rpsI
Definition
30S ribosomal protein S9
Orthology
K02996  
small subunit ribosomal protein S9
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:lla03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(2346315..2346707)
Genome map
AA seq 130 aa AA seqDB search
MAQVQYAGTGRRKNAVARVRLVPGTGKITVNGREVESYIPHADMRLVINQPFAATQTEGS
YDTLVNVNGGGVSGQAGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKK
ARKASQFSKR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtacaatatgccggcacaggccgtcgtaaaaatgcagtagcacgcgtacgt
ctcgtacctggtactggtaaaatcacagttaacggacgtgaagtagaaagctacatccca
cacgcagacatgcgtctcgttatcaaccaaccatttgcagctacacaaacagaaggtagc
tacgatacactcgtaaacgtaaatggtggtggtgtatcaggtcaagcaggagctatccgt
cacggaatcgctcgtgcattactccaagtagacccagatttccgtagtgctttgaaacgc
gctggactccttacacgtgacgcccgtatggttgaacgtaaaaaaccaggtctcaaaaaa
gcccgtaaagcatcacaattctcaaaacgttaa

DBGET integrated database retrieval system