KEGG   Lactococcus lactis subsp. lactis IL1403: L100350Help
Entry
L100350           CDS       T00045                                 

Gene name
yejJ
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lla00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lla00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
500356..501567
Genome map
AA seq 403 aa AA seqDB search
MTKRLKKKAKPVVFLALVLGCALILSGVLGLAGHLNEQESSKTKKKSQLSETKRSSTSPK
NMDKNIEQMTLEQKVGQLFMTGMPANNYNQATFDAIEKYQVGSIILTGRSNLSVPEMKDI
TDKLQGLEPANRKLLISCDQEGGNVQVLQGQGFSQIPDGLTQGSWTADKLQKESQTWGSE
LYAAGVNFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKASIISHAQAFTEGMKAAKVL
TTAKHFPGLGAVTGNTDISAGVRDDQTNSNSESVQIFKDLISSGTPSIMTATAIYDKIDP
NLPGAFSSKMVDGLLRKQLGFDGLVITDDLSNAVQVQSWTPGQRAVLALSAGNDLVLANE
PTQIPEMISEVLQKVKADPDFAKKISQSATRVIKVKEEMKLVE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcgcttaaagaaaaaagcaaaaccagttgtttttctagctcttgttcttggt
tgtgcattaattttatcaggagttcttggtttggcgggacatttaaacgaacaagaatcg
tctaaaacaaaaaagaaaagtcaattgtcagaaactaaaaggagttcaacttccccaaaa
aatatggataaaaatattgagcagatgactttggaacaaaaagttggtcagttatttatg
acaggaatgccagcaaataactataatcaggcaacttttgatgcgattgaaaagtatcaa
gtaggtagtattattttgactggtcgctctaatctcagtgtcccagaaatgaaagatatt
actgacaaactacaaggcttagaaccggctaatcgcaaactcttgatatcctgtgaccaa
gagggaggaaatgttcaagttctccaaggtcagggtttttcacagattcctgatggatta
actcaaggaagttggacagctgataaattacaaaaggaatcacaaacttggggaagtgaa
ctttacgcagctggagtgaattttgacttagcaccagttgctgaccaagttttatctgcc
gactttgctccacaaaatgctccaattggctattggagtcgccaatatgcttatgataaa
gcaagtatcataagccatgctcaagcatttacggaaggcatgaaagcagccaaggttttg
acaactgctaaacattttccagggcttggagcggtgacaggcaatacagatatcagtgca
ggtgttagagatgaccaaacgaattccaatagcgaatctgttcaaattttcaaagattta
atctcttctgggacaccttcgattatgaccgcaaccgctatttatgataaaattgaccct
aatcttcccggtgctttttcatccaaaatggttgatggtttactacggaaacaattaggc
tttgatggtttggttattacagatgatttatcaaatgctgtccaagtacaatcatggacg
cctggtcaaagggcagttttagcattgtcagcaggaaatgaccttgttttagcaaatgag
cctacacaaattccagaaatgatctcagaagttttgcaaaaggtaaaagcagacccagac
tttgctaaaaaaatcagtcaatcagccacaagagtgattaaagtaaaagaagaaatgaaa
cttgtagaatag

DBGET integrated database retrieval system