KEGG   Lactococcus lactis subsp. lactis IL1403: L119614Help
Entry
L119614           CDS       T00045                                 

Gene name
ypcA
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lla00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1519866..1521293)
Genome map
AA seq 475 aa AA seqDB search
MELKFQENFLWGAATSGPQTEGRFKKQHDNVFDYDFDHYQERFWGGIGPDTASNFFNDFR
EDIKLMKAAGLKSIRTSIQWSRLIDDLEKNTVNEKAVDFYNAVINEFIAQGIRPMINLNH
FDLPVELLKTYGGWESPHVVDLYAGFAAKCFAEFSDRVSDWFTFNEPMVVVECAYLLGFH
YPDIVDGKKAVQVAYHLQLASSLAIEQYRKINKNPEGRIGIILNLTPSYPAAEKIEDLKA
AEMADLWQNRLFLDASIKGEFPEELVSLLQEENVLWQSEAEDLKRIKENKVDLLGVNYYH
PSRVQEPEYSSDSLAQDWRPDKYYASFNKRGVRMNADRGWEIHPQTIYEIAKRIQEDYGN
ISWFISENGMGVENEEHFKDEEGQIQDDYRIIFTTEHLFWLHKAIQEGSNCFGYHVWTPI
DCWSWRNSYKNRYGLISLNIHTQVKTLKKSAYWYKNLTDSSLLQVPDSILEKYNQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaattaaaattccaagaaaattttttgtggggagcagcaacgagtggcccacaaact
gaaggacgttttaaaaagcagcatgacaatgtttttgattatgattttgaccattatcaa
gaacgtttttggggcggaattggacctgatacagccagtaattttttcaatgactttcga
gaagatataaaattaatgaaggctgctggtctaaaatcaataaggacaagtattcaatgg
tcgcgtttgatagatgatttagaaaagaatacggtaaatgaaaaggcggttgatttctat
aatgctgtaattaatgaatttatagcgcaagggattcgcccgatgattaatttaaatcat
tttgatttaccagttgaactcttaaaaacatatggaggctgggaaagtcctcatgttgtt
gatttatatgcaggttttgcagcaaaatgttttgctgaattcagcgaccgagtgagtgat
tggtttacttttaatgagccaatggttgtcgttgagtgtgcttatctattaggtttccat
tatcctgatattgttgatggaaaaaaagctgttcaagtggcttatcatttgcaactcgcc
tcatctcttgcgattgaacaataccgaaaaatcaataaaaatcctgaaggacgaattgga
atcattttaaatttaactccgtcctatccagcagctgaaaaaatagaagatttaaaagca
gcagaaatggcagacctttggcaaaatcgcctctttttagatgcatcaataaagggagaa
tttccagaagaattagtcagccttttacaagaagaaaatgtcttgtggcagtcggaagca
gaagatttgaaacggattaaggaaaacaaagtggaccttttgggagttaattactaccat
ccgagtcgagtacaagaacctgaatattctagtgatagtttggctcaagattggcgtccc
gacaaatattacgcatcgttcaataaacgtggggtgcggatgaatgctgacagaggttgg
gagatacatccacaaaccatttacgaaattgccaagcgaattcaagaagattatggaaat
atttcttggtttatttctgaaaatgggatgggcgtagaaaatgaagaacatttcaaagat
gaagagggacaaatccaagatgattatcgaattatttttacaacagaacatcttttttgg
ctccataaagcgattcaagaaggctccaattgttttggttaccatgtttggacaccaatt
gattgctggagttggcgtaattcatacaaaaatcgttatggtttgattagtttgaatatc
catacccaagtgaaaactttaaaaaaatcagcttattggtataaaaatttaacagactca
tcacttttacaagttccagattcaattttagaaaaatacaatcaatga

DBGET integrated database retrieval system