KEGG   Lactococcus lactis subsp. lactis IL1403: L126168Help
Entry
L126168           CDS       T00045                                 

Gene name
lnbA
Definition
lacto-N-biosidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lla  Lactococcus lactis subsp. lactis IL1403
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lla00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:lla00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1526420..1527397)
Genome map
AA seq 325 aa AA seqDB search
MEKGLLVDIGRKYWSIAELKRLVLLLQEHKLTHLQLHLNENEGFALNFTDSPVSKKYSEN
MLKELKEFAKTHEITLIPDFDSPGHMGSLLEQNPEFALPDSNQQAVDVTNPAVIDWIMGI
IDKIVDIFPDSDTFHIGADEFIDFRQIEKYPYLVEKTREKYGNKASGLEFYYDYVNQLTE
HLQKKGKQVRIWNDGFLRKDLQSLVPLNKNVEVCYWTNWDKGMAEVKEWLTKGYTLINFC
DNDLYYVLGEEAGYSYPTAEKLEREGKIQKFSGQQYLNQEEMKAVRGTYFSIWADNAAAK
SVSEILDDLSKVLPVFMKIYGGNDE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggattattagtcgatattggacgaaaatattggtcaatagcagagttaaaa
agattagttcttttacttcaagagcataagctgacacatttacaacttcatctcaatgaa
aatgaaggatttgcgctaaattttactgacagccctgtcagtaaaaaatattcagaaaat
atgctcaaagaattgaaagaatttgcaaaaacacacgaaatcactttgattcctgatttt
gatagtccaggtcacatgggctccttattagagcaaaatcctgaatttgcactacctgac
agcaatcaacaagcggtagatgttactaatccagcagtcattgattggattatgggaata
attgataagatagtcgatattttcccagattcagatacttttcatatcggggctgatgaa
tttattgattttcggcaaattgaaaaatatccttatttagtggagaaaactcgggaaaaa
tatggaaataaggcaagtggtttagagttttattatgactatgttaatcaattgaccgag
catttgcagaaaaaaggaaaacaagttcgtatttggaatgatggatttttacgaaaagac
cttcagtcattggttcctttgaataaaaatgtggaggtttgttattggacaaactgggac
aaagggatggcagaagtcaaagaatggttaactaagggttataccttaataaatttttgt
gataatgacctttattatgttttaggtgaagaagcaggctattcttatccaacggctgaa
aaactggaaagggaaggaaaaattcaaaaattttctggtcagcaatatttaaatcaagaa
gagatgaaagctgtcagaggaacttacttttcgatttgggctgacaatgctgcagctaag
tctgtcagtgaaattttagacgatcttagcaaggtacttccggtatttatgaaaatttat
ggaggaaatgatgaataa

DBGET integrated database retrieval system