KEGG   Lactococcus lactis subsp. lactis Il1403: L126168Help
Entry
L126168           CDS       T00045                                 

Gene name
lnbA
Definition
lacto-N-biosidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    L126168 (lnbA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    L126168 (lnbA)
Enzymes [BR:lla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     L126168 (lnbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
Position
complement(1526420..1527397)
Genome map
AA seq 325 aa AA seqDB search
MEKGLLVDIGRKYWSIAELKRLVLLLQEHKLTHLQLHLNENEGFALNFTDSPVSKKYSEN
MLKELKEFAKTHEITLIPDFDSPGHMGSLLEQNPEFALPDSNQQAVDVTNPAVIDWIMGI
IDKIVDIFPDSDTFHIGADEFIDFRQIEKYPYLVEKTREKYGNKASGLEFYYDYVNQLTE
HLQKKGKQVRIWNDGFLRKDLQSLVPLNKNVEVCYWTNWDKGMAEVKEWLTKGYTLINFC
DNDLYYVLGEEAGYSYPTAEKLEREGKIQKFSGQQYLNQEEMKAVRGTYFSIWADNAAAK
SVSEILDDLSKVLPVFMKIYGGNDE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggattattagtcgatattggacgaaaatattggtcaatagcagagttaaaa
agattagttcttttacttcaagagcataagctgacacatttacaacttcatctcaatgaa
aatgaaggatttgcgctaaattttactgacagccctgtcagtaaaaaatattcagaaaat
atgctcaaagaattgaaagaatttgcaaaaacacacgaaatcactttgattcctgatttt
gatagtccaggtcacatgggctccttattagagcaaaatcctgaatttgcactacctgac
agcaatcaacaagcggtagatgttactaatccagcagtcattgattggattatgggaata
attgataagatagtcgatattttcccagattcagatacttttcatatcggggctgatgaa
tttattgattttcggcaaattgaaaaatatccttatttagtggagaaaactcgggaaaaa
tatggaaataaggcaagtggtttagagttttattatgactatgttaatcaattgaccgag
catttgcagaaaaaaggaaaacaagttcgtatttggaatgatggatttttacgaaaagac
cttcagtcattggttcctttgaataaaaatgtggaggtttgttattggacaaactgggac
aaagggatggcagaagtcaaagaatggttaactaagggttataccttaataaatttttgt
gataatgacctttattatgttttaggtgaagaagcaggctattcttatccaacggctgaa
aaactggaaagggaaggaaaaattcaaaaattttctggtcagcaatatttaaatcaagaa
gagatgaaagctgtcagaggaacttacttttcgatttgggctgacaatgctgcagctaag
tctgtcagtgaaattttagacgatcttagcaaggtacttccggtatttatgaaaatttat
ggaggaaatgatgaataa

DBGET integrated database retrieval system