KEGG   Lactococcus lactis subsp. lactis Il1403: L13145Help
Entry
L13145            CDS       T00045                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lla  Lactococcus lactis subsp. lactis Il1403
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lla00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    L13145 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L13145 (adhE)
   00620 Pyruvate metabolism
    L13145 (adhE)
   00650 Butanoate metabolism
    L13145 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    L13145 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    L13145 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L13145 (adhE)
   00626 Naphthalene degradation
    L13145 (adhE)
Enzymes [BR:lla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     L13145 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     L13145 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2229727..2232438
Genome map
AA seq 903 aa AA seqDB search
MATKKAAPAAKKVLSAEEKAAKFQEAVAYTDKLVKKAQAAVLKFEGYTQTQVDTIVAAMA
LAASKHSLELAHEAVNETGRGVVEDKDTKNHFASESVYNAIKNDKTVGVISENKVAGSVE
IASPLGVLAGIVPTTNPTSTAIFKSLLTAKTRNAIVFAFHPQAQKFSSHAAKIVYDAAIE
AGAPEDFIQWIEVPSLDMTTALIQNRGLATILATGGPGMVNAALKSGNPSLGVGAGNGAV
YVDATANIERAVEDLLLSKRFDNGMICATENSAVIDASVYDEFIAKMQEQGAYMVPKKDY
KAIESFVFVERAGEGFGVTGPVAGRSGQWIAEQAGVKVPKDKDVLLFELDKKNIGEALSS
EKLSPLLSIYKAETREEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGEKVEASRIL
VNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVR
LPKEIYYEKNAISYLQELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSV
QPDPTLSEAIAIARQMKQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLK
ELFQELAQKFVDIRKRIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLAD
YQLTPQVAIVDPEFVMTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFE
NLTESYHYDPAHPTKEGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGL
AIAIAMPHVIKFNAVTGNVKRTPYPRYETYRAQEDYAEISRFMGFAGKDDSDEKAVQALV
AELKKLTDSIDINITLSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKQLLL
DQY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccgctccagctgcaaagaaagttttaagcgctgaagaaaaagcc
gcaaaattccaagaagctgttgcttatactgacaaattagtcaaaaaagcacaagctgct
gttcttaaatttgaaggatatacacaaactcaagtcgatactattgtcgctgcaatggct
cttgcagcaagcaaacattctctagaactcgctcatgaagccgttaacgaaactggtcgt
ggtgttgtcgaagacaaagataccaaaaatcactttgcttctgaatctgtttataacgca
attaaaaatgacaaaactgttggtgtcatttctgaaaacaaggttgctggatctgttgaa
atcgcaagccctctcggtgtacttgctggtatcgttccaacgactaatccaacatcaaca
gcaatctttaaatctttattgactgcaaaaacacgtaatgctattgttttcgctttccat
cctcaagctcaaaaattttcaagccatgcagcaaaaattgtttacgatgctgcaattgaa
gctggtgcaccggaagactttattcaatggattgaagtaccaagccttgacatgactacc
gccttgattcaaaaccgtggacttgcaacaatccttgcaactggtggcccaggaatggta
aacgccgcactcaaatctggtaacccttcactcggtgttggagctggtaatggtgctgtt
tatgttgatgcaactgcaaatattgaacgtgccgttgaagaccttttgctttcaaaacgt
tttgataatgggatgatttgtgccactgaaaattcagctgttattgatgcttcagtttat
gatgaatttattgctaaaatgcaagaacaaggcgcttatatggttcctaaaaaagactac
aaagctattgaaagtttcgtttttgttgaacgtgctggtgaaggttttggagtaactggt
cctgttgccggtcgttctggtcaatggattgctgaacaagctggtgtcaaagttcctaaa
gataaagatgtccttctttttgaacttgataagaaaaatattggtgaagcactttcttct
gaaaaactttctcctttgctttcaatctacaaagctgaaacacgtgaagaaggaattgag
attgtacgtagcttacttgcttatcaaggtgctggacataatgctgcaattcaaatcggt
gcaatggatgatccattcgttaaagaatatggcgaaaaagttgaagcttctcgtatcctc
gttaaccaaccagattctattggtggggtcggagatatctatactgatgcaatgcgtcca
tcacttacacttggaactggttcatgggggaaaaattcactttcacacaatttgagtaca
tacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgcccacaatgggttcgt
ttgccaaaagaaatttactacgaaaaaaatgcaatttcttacttacaagaattgccacac
gtccacaaagctttcatcgttgctgaccctggtatggttaaatttggtttcgttgataaa
gttttggaacaacttgctatccgcccaactcaagttgaaacaagcatttatggctctgtt
caacctgacccaactttgagcgaagcaattgcaatcgctcgtcaaatgaaacaatttgaa
cctgacactgtcatctgtcttggtggtggttctgctctcgatgccggtaagattggtcgt
ttgatttatgaatatgatgctcgtggtgaagctgacctttctgatgatgcaagtttgaaa
gaacttttccaagaattagctcaaaaatttgtcgatattcgtaaacgtattattaaattc
taccatccacataaagcacaaatggttgcaattcctactacttctggtactggttctgaa
gtgactccatttgcagttatcactgatgatgaaactcatgttaagtacccacttgctgac
taccaattaacaccacaagttgccattgttgaccctgagtttgttatgactgtaccaaaa
cgtactgtttcttggtctggtattgatgcgatgtcacacgcgcttgaatcttacgtttct
gttatgtcttctgactatacaaaaccaatttcacttcaagcgatcaaacttatctttgaa
aacttgactgagtcttatcattatgacccagcgcatccaactaaagaaggacaaaaagcc
cgcgaaaacatgcacaatgctgcaacactcgctggtatggccttcgctaatgctttcctt
ggaattaaccactcacttgctcataaaattggtggtgaatttggacttcctcatggtctt
gccattgccatcgctatgccacatgtcattaaatttaacgctgtaacaggaaacgttaaa
cgtaccccttacccacgttatgaaacatatcgtgctcaagaggactacgctgaaatttca
cgcttcatgggatttgctggtaaagatgattcagatgaaaaagctgtgcaagctctggtt
gctgaacttaagaaactgactgatagcattgatattaatatcaccctttcaggaaatggt
gtcgataaagctcaccttgaacgtgaacttgataaattggctgaccttgtttatgatgat
caatgtactcctgctaatcctcgtcaaccaagaattgatgagattaaacagttgttgtta
gatcaatactaa

DBGET integrated database retrieval system